[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54034.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:106 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   42->95 PF02155 * GCR 0.0005 29.6 54/370  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54034.1 GT:GENE ACV54034.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 54738..55058 GB:FROM 54738 GB:TO 55058 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV54034.1 GB:DB_XREF GI:257473714 InterPro:IPR012902 LENGTH 106 SQ:AASEQ MIGKTTRVLREKLQDCHGDTMVEVLAAVFIAALGATMLATMVTVSATASARSQQVLNASYAAEASLYDSSSYGPVVSVTLPDSSTAVPIKVSVYQSGGYAYYEEGR GT:EXON 1|1-106:0| TM:NTM 1 TM:REGION 23->45| SEG 35->50|atmlatmvtvsatasa| HM:PFM:NREP 1 HM:PFM:REP 42->95|PF02155|0.0005|29.6|54/370|GCR| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-18,20-20,25-26,31-32,34-34,39-40,45-46,48-48,53-54,59-60,62-62,67-67| PSIPRED cccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHEEcccHHHHHHHHHHHHcccHHccccccccEEEEEEccccccEEEEEEEEEcccEEEccccc //