[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54041.1
DDBJ      :             Tfp pilus assembly protein ATPase PilM-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  99/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.55.1
:331 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   3->307 1e4gT PDBj 3e-06 11.5 %
:RPS:SCOP  1->68 2ch5A2  c.55.1.5 * 4e-04 15.2 %
:HMM:SCOP  40->166 2bh1A2 c.55.1.11 * 1.4e-13 22.2 %
:HMM:SCOP  172->332 1jcfA2 c.55.1.1 * 4.1e-09 23.9 %
:RPS:PFM   33->155 PF11104 * Competence_A 1e-15 35.8 %
:HMM:PFM   33->159 PF11104 * Competence_A 1.2e-17 30.6 124/146  
:HMM:PFM   6->58 PF02491 * FtsA 0.00046 30.4 46/172  
:BLT:SWISS 15->155 GSPL_AERHY 8e-06 29.6 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54041.1 GT:GENE ACV54041.1 GT:PRODUCT Tfp pilus assembly protein ATPase PilM-like protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 61060..62055 GB:FROM 61060 GB:TO 62055 GB:DIRECTION + GB:PRODUCT Tfp pilus assembly protein ATPase PilM-like protein GB:NOTE KEGG: gbm:Gbem_1546 type IV pilus assembly protein PilM GB:PROTEIN_ID ACV54041.1 GB:DB_XREF GI:257473721 LENGTH 331 SQ:AASEQ MGKTYTGVDIGDSSIKLAVSDGQSVSKVAIEMLPEGLVADGRIVSHDAMADFIKSVVRSIGGVSKDVAFVVPSSDSLFRRLSLPAMTEKELRLNLPYEFRDYISQGKDRYVYDYAMLGMRNDADGQPEGMDLLAVAAPKQAIADYTEMFRRAGLKLKVALPEQAAYQNLVGGNPRALANCCVIDFSHHMTKLHFFLDGAYDVARVIEIGGIDIDRAIANEYGVDEHVADQYKRTDYQGAQCSEAARAVYQSIAIEIGRALNFYGFNNPDAVIEVAYCCGGGLLLDPLVEAVAAHVDLRVSSIVDVLPPMSAPLGEALRCPVAIGATMKAGR GT:EXON 1|1-331:0| BL:SWS:NREP 1 BL:SWS:REP 15->155|GSPL_AERHY|8e-06|29.6|125/100| RP:PDB:NREP 1 RP:PDB:REP 3->307|1e4gT|3e-06|11.5|287/375| RP:PFM:NREP 1 RP:PFM:REP 33->155|PF11104|1e-15|35.8|120/144|Competence_A| HM:PFM:NREP 2 HM:PFM:REP 33->159|PF11104|1.2e-17|30.6|124/146|Competence_A| HM:PFM:REP 6->58|PF02491|0.00046|30.4|46/172|FtsA| RP:SCP:NREP 1 RP:SCP:REP 1->68|2ch5A2|4e-04|15.2|66/117|c.55.1.5| HM:SCP:REP 40->166|2bh1A2|1.4e-13|22.2|117/0|c.55.1.11|1/1|Actin-like ATPase domain| HM:SCP:REP 172->332|1jcfA2|4.1e-09|23.9|159/0|c.55.1.1|1/1|Actin-like ATPase domain| OP:NHOMO 100 OP:NHOMOORG 100 OP:PATTERN -------------------------------------------------------------------- -1--------------------------------------1---1---1-------------------------------1-----------------------------------------------------------------11-1111--11------111-11--------------1-1------------------------------------------------------------------------------------------------------------------------------------------1-------------1---1--1--------1---1---11--111----1-----------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111---------11-11111111----------11111111111111111-------------------------1----------------------------------11-1--------------------------------------------------------------------------------------------1-----11111-11----------------111111------------1----------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 298 STR:RPRED 90.0 SQ:SECSTR ##EEEEEEEEcccEEEEEEEcccccEEEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHTcTTcEEEEEEEEEEcTTccEEccHHHHHHHHHHHHHHccTTEEEEEEccEEcccTTEEcEEEEEEEEEEEEHHHHHHHHHHHTTccccEEEEEHHHHHHHHHccHHHHHHccccEEEEEcccccEEEEEEEETTEEEEEEEEcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccTTccccEEEEEcTTcccEEEEEHHHHHE#######HHHHHHHHHHHHHHHHHHHHHTcccc######################## DISOP:02AL 330-332| PSIPRED cccEEEEEEEEccEEEEEEcccccEEEEEEEEcccccccccEEEcHHHHHHHHHHHHHHccccccEEEEEEccccEEEEEEEcccccHHHHHHHHHHHHHHcccccHHHEEEccEEcccccccccccEEEEEEEEEEEHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHccccccccEEEEEEcccEEEEEEEEccEEEEEEEEEccHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEccccccccHHHHHHHHHccccEEEccccccccHHHHHHHccHHHHHHHHHHcc //