[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54055.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  13/68 : Bacteria  108/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:467 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   28->126 PF04326 * AAA_4 6e-09 35.8 %
:HMM:PFM   13->129 PF04326 * AAA_4 5.8e-23 29.6 115/122  
:BLT:SWISS 135->205 POLN_ONNVG 8e-04 34.3 %
:BLT:SWISS 189->383 RECG_THIFE 6e-15 32.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54055.1 GT:GENE ACV54055.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(77497..78900) GB:FROM 77497 GB:TO 78900 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:NOTE PFAM: AAA-4 family protein; KEGG: gur:Gura_2922 putative transcriptional regulator GB:PROTEIN_ID ACV54055.1 GB:DB_XREF GI:257473735 InterPro:IPR007421 LENGTH 467 SQ:AASEQ MQKDGIFGKFIAETTSIDYKVTLEETKPKSWLKSVCAFANGTGGMLAFGIDDKGHLVGLDDPQHVAEKASELINARIDPTPPFRLEAVEEDDCRIVLLRVGPGDDCPYVYVGDGSQIVYVRSGNQSLPASSVQLRSLSMRGSHTHFDEIETAFRKDDYSFETLRASYFERTGDRLADTDFVSFGLAKSDGLLTNAGVLLADQPILRQNRVFCTRWNGLDKAKVDGEVLDDHEYSGCLVKLLREAMDFVDRHNRVAWTKTDDDRIETPSYVMRAVEEALVNALIHRRYEIGGAEVTVYVFDDRLEITSPGGKVDGMLHEDADLGAIESVRRNPVIADLFQRMRFMERKGSGLKLIRERTALAPNYEERFMPRFVDDGRFFKVVLWNMNLDAPQDTPQDTPQDTPQVKAVLEALGESEMSLVELMGKIGLADRKNFRDLYLKPSLDSGLIEMTIPGKPTSRNQRYRAVK GT:EXON 1|1-467:0| BL:SWS:NREP 2 BL:SWS:REP 135->205|POLN_ONNVG|8e-04|34.3|70/100| BL:SWS:REP 189->383|RECG_THIFE|6e-15|32.4|185/652| SEG 391->404|pqdtpqdtpqdtpq| RP:PFM:NREP 1 RP:PFM:REP 28->126|PF04326|6e-09|35.8|95/117|AAA_4| HM:PFM:NREP 1 HM:PFM:REP 13->129|PF04326|5.8e-23|29.6|115/122|AAA_4| GO:PFM:NREP 1 GO:PFM GO:0005524|"GO:ATP binding"|PF04326|IPR007421| OP:NHOMO 158 OP:NHOMOORG 121 OP:PATTERN --------------------------------2-----11-1--12321-4-1-2--1---------- 1----21-1111----------------------------1--1---1---------------------------1----1-------1132-121------1------------------------436---3--11122---1------------------1----------------------12-------------------------------------------------1------------------1--1---------------1--------1--------------------------------------1-1--------------11-----------1--11--1-----------11---------------------------------------------------1-12--1-----------1--------------------------------------------------------1----------------------------------------2------1--11---------------11--11------------------31-------1------1-1---------------1-11----1------------------1---1-----12-----------1---------------------------------------2--------------------------------------------------1-2--1----1-1-1-1--1-------------2---------------1--1111-111------1--1--------1111--------------------------------------1------1----111--11--------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 467-468| PSIPRED ccccHHHHHHcccccEEEEEEHHccccHHHHHHHHHHHHcccccEEEEEEccccEEcccccHHHHHHHHHHHHHHcccccccEEEEEEEEccEEEEEEEEcccccccEEEEEccccEEEEEEccccEEccHHHHHHHHHHHccccHHHHccccccccccHHHHHHHHHHHccccccHHHHHHccccccccccHHHHHHHccccccccEEEEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHcccccEEEEcccccccccccHHHHHHHHHHHHHHHHHccccccEEEEEcccEEEEEEcccccccccHHHHHHcccccccccHHHHHHHHHcccHHHHccHHHHHHHHHHcccccccccccEEEEcccEEEEEEEcccccccccccHHHHcccHHHHHHHHHHHccccHHHHHHHHHccccccHHHHHHHHHHHHcccEEEEccccccccccccEEcc //