[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54060.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:368 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 201->351 METK_CORA7 7e-05 28.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54060.1 GT:GENE ACV54060.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(85881..86987) GB:FROM 85881 GB:TO 86987 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE KEGG: rfr:Rfer_4437 hypothetical protein GB:PROTEIN_ID ACV54060.1 GB:DB_XREF GI:257473740 LENGTH 368 SQ:AASEQ MTIRNSVETARASVSNIESYISKKWPGFFDEIATTLSKPLWRMGKNDMFAICDQDIDDINKVQFLAIQERAIQRILLSSKTLQRPGGAWDCIPPIDLANLCCDWKRSPVVLEFNSSLVEELQRSDIDPDVDLSEHLEHLPFSCFFISAEHLGFRLSNADGKLKHAVGFFLDYAWMPRSDQPHRVEKHFIITIIGSNGYTIPVVIPLRFSTIKDLSAYVVETYLQANGGKSKMIKVFVDEDLHTILSLLLYIASKEPDIVEKEIARRKDTNDLDRSSTFNNDQEPLDEPRTFLVGGKIGPSIEAHRHANKNAGSGRAITPHIRRAHFHTYLTGSRKDRTQKRILKWVAQTSVNMEKEGDASTVMVRKVE GT:EXON 1|1-368:0| BL:SWS:NREP 1 BL:SWS:REP 201->351|METK_CORA7|7e-05|28.9|142/100| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-18,20-20,25-25,53-53,59-60,62-62,67-67,87-88,90-90,95-95,221-221,283-283,286-286,291-291,297-297,300-300,305-305,361-361,367-369| PSIPRED ccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccEEHHHHccccccccEEEEEEHHHHHHHHHHccHHHccccccccccccHHHHHHccccccccEEEEEcHHHHHHHHHccccccccHHHHHHHcccEEEEEEccccEEEEccccccHHHHHHHHHHHcccccccccccEEEEEEEEEEccccEEEEEEEEEEEHHHHHHHHHHHHHHHHccccccEEEEEEEcccHHHHHHHHHHHHccccHHHHHHHHHHcccccccccccccccccccccccEEEEccccccccHHHHccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccccccEEEEEEcc //