[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54068.1
DDBJ      :             transcriptional regulator, BadM/Rrf2 family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  98/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5a.49.1
:158 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->130 1xd7A PDBj 1e-05 25.9 %
:RPS:PDB   13->66 2acjC PDBj 4e-06 14.8 %
:RPS:SCOP  10->84 1f6vA  a.49.1.1 * 1e-07 22.7 %
:HMM:SCOP  5->130 1xd7A_ a.4.5.55 * 2.9e-25 29.8 %
:RPS:PFM   1->81 PF02082 * Rrf2 2e-14 43.2 %
:HMM:PFM   1->81 PF02082 * Rrf2 3.1e-26 39.5 81/83  
:BLT:SWISS 1->82 NSRR_PROMH 2e-12 37.8 %
:PROS 47->65|PS01332|HTH_RRF2_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54068.1 GT:GENE ACV54068.1 GT:PRODUCT transcriptional regulator, BadM/Rrf2 family GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 100493..100969 GB:FROM 100493 GB:TO 100969 GB:DIRECTION + GB:PRODUCT transcriptional regulator, BadM/Rrf2 family GB:NOTE TIGRFAM: transcriptional regulator, Rrf2 family; PFAM: protein of unknown function UPF0074; Helix- turn-helix type 11 domain protein; KEGG: rbo:A1I_03475 putative transcriptional regulator GB:PROTEIN_ID ACV54068.1 GB:DB_XREF GI:257473748 InterPro:IPR000944 InterPro:IPR013196 LENGTH 158 SQ:AASEQ MQLKASTDYGMRAILYLAAQGTTCSSKDIAEDMSIPRDYLIQLAQLLRNAGIIEARPGKHGGYRLAKDPADTNVLEIMEALDDDAKQSTRAKRDARKGGAMVQEIKQVYDLIEESMDAYLSSLTVQMLLDCARNGDNSRTFLAERLQEESRRLLDAVK GT:EXON 1|1-158:0| BL:SWS:NREP 1 BL:SWS:REP 1->82|NSRR_PROMH|2e-12|37.8|82/142| PROS 47->65|PS01332|HTH_RRF2_1|PDOC01035| BL:PDB:NREP 1 BL:PDB:REP 14->130|1xd7A|1e-05|25.9|108/116| RP:PDB:NREP 1 RP:PDB:REP 13->66|2acjC|4e-06|14.8|54/66| RP:PFM:NREP 1 RP:PFM:REP 1->81|PF02082|2e-14|43.2|81/83|Rrf2| HM:PFM:NREP 1 HM:PFM:REP 1->81|PF02082|3.1e-26|39.5|81/83|Rrf2| RP:SCP:NREP 1 RP:SCP:REP 10->84|1f6vA|1e-07|22.7|66/91|a.49.1.1| HM:SCP:REP 5->130|1xd7A_|2.9e-25|29.8|124/127|a.4.5.55|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 108 OP:NHOMOORG 98 OP:PATTERN -------------------------------------------------------------------- -1--------------------------------------1---------------------1----------------11-1----------------------------------------------1-----1---1------1------1--1--------1111--------------11111-1---------------------1111------------------------------------------------------------------------------------------------------------1----2222222-2-----------2-------1111----11---2-1-1-------------------------------------------------11---1-----1------1----------------11----1--------------11------11----------1---------------------------------------1-1-------------1----------------1------11-----1--1---1111111-1-1-------------------1------11-----1----------------------------1--------11-1------------------------------------111-----------------------------------------------1111-------------------------------1--------------------------1----------------1-1-1-11----------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 123 STR:RPRED 77.8 SQ:SECSTR ##HHTccHHHHHHHHHHTcTTccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEcccccEEEEcccccccHHHHHHHHHHHHHHHTc#####cHHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHcc############################ DISOP:02AL 158-159| PSIPRED ccccHHHHHHHHHHHHHHHcccEEcHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEcccccccccccHHHccHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHcccccccHHHHHccHHHHHHHHHcc //