[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54072.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.1.26
:129 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   35->112 2h7wB PDBj 1e-06 31.2 %
:RPS:SCOP  31->118 2c34A1  b.1.26.1 * 4e-14 28.7 %
:HMM:SCOP  31->118 2h7wA1 b.1.26.1 * 3e-14 34.1 %
:RPS:PFM   35->116 PF09394 * Chagasin_I42 7e-08 42.1 %
:HMM:PFM   31->117 PF09394 * Chagasin_I42 3.3e-23 37.6 85/100  
:BLT:SWISS 35->108 CHAG_TRYCR 7e-06 30.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54072.1 GT:GENE ACV54072.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 105050..105439 GB:FROM 105050 GB:TO 105439 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE KEGG: pfl:PFL_4924 putative lipoprotein GB:PROTEIN_ID ACV54072.1 GB:DB_XREF GI:257473752 LENGTH 129 SQ:AASEQ MAAFVAFAVGCSAAPGSEVQIAEGSAEFSQSNLVVKLDANPTTGYEWTFQIDGSAVQPDGDEFVPASDGAQPKTGEGGVHTFNFKADGSGEATLTFTYARSWEASDSDKSVVLHATVENGAFTQVEEQA GT:EXON 1|1-129:0| BL:SWS:NREP 1 BL:SWS:REP 35->108|CHAG_TRYCR|7e-06|30.1|73/110| BL:PDB:NREP 1 BL:PDB:REP 35->112|2h7wB|1e-06|31.2|77/108| RP:PFM:NREP 1 RP:PFM:REP 35->116|PF09394|7e-08|42.1|76/100|Chagasin_I42| HM:PFM:NREP 1 HM:PFM:REP 31->117|PF09394|3.3e-23|37.6|85/100|Chagasin_I42| RP:SCP:NREP 1 RP:SCP:REP 31->118|2c34A1|4e-14|28.7|87/113|b.1.26.1| HM:SCP:REP 31->118|2h7wA1|3e-14|34.1|85/0|b.1.26.1|1/1|ICP-like| OP:NHOMO 7 OP:NHOMOORG 6 OP:PATTERN --------------------------------------1111--------1----------------- --------------------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 84 STR:RPRED 65.1 SQ:SECSTR ##################################EEEEEcGGGTcEEEETTTcccccccTTTEEEEEEEEccTTTccEEEEEEEEEccccEEEEEEEEEcTTccTTcEEEEEEEEEEc########### DISOP:02AL 129-130| PSIPRED cHHHHHHHHEEEcccccEEEEEcccccccccEEEEEEcccccccEEEEEEcccccEEEEcccEEccccccccccccccEEEEEEEEccccEEEEEEEEEccccccccccEEEEEEEEEcccEEEEcccc //