[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54073.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:265 amino acids
:PSIPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54073.1 GT:GENE ACV54073.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(105497..106294) GB:FROM 105497 GB:TO 106294 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE KEGG: bcz:BCZK3299 ABC transporter, permease GB:PROTEIN_ID ACV54073.1 GB:DB_XREF GI:257473753 LENGTH 265 SQ:AASEQ MNRALFAKELRANLFVSLIIAAVLAMYIGVIVSMYDPELGESLDAMMQSMPEMFAAFGMSVQATTLIDFMLNYLYGFLLTIFILVLILIVANKLMVRYLDRSAMAYLLATPNSRTRIALTMVGVMVTILVALMAVVTALEVGFAEALFPGELDMQALMQVNAGLLALWLAMAGLCFLSACLFSNATAALWVGGGLNILFFLMQMISQVGDKFEFLKNVNPLTLFDYYGLAAGDASAVGGAIALAVGAVALFAVAVAAFDRRDLSI GT:EXON 1|1-265:0| TM:NTM 6 TM:REGION 14->36| TM:REGION 64->86| TM:REGION 120->142| TM:REGION 159->181| TM:REGION 187->209| TM:REGION 235->257| SEG 77->90|flltifilvliliv| SEG 162->174|agllalwlamagl| SEG 234->258|asavggaialavgavalfavavaaf| OP:NHOMO 22 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------1-1121-1-1111--11--111--1---1-------1-----------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccHHHHccHHHHHHHccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccHHHcccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //