[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54086.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:121 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   11->94 PF03208 * PRA1 0.00023 26.2 80/154  
:BLT:SWISS 36->95 TNAB_ECO57 6e-04 30.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54086.1 GT:GENE ACV54086.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 121961..122326 GB:FROM 121961 GB:TO 122326 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV54086.1 GB:DB_XREF GI:257473766 LENGTH 121 SQ:AASEQ MFARLLRIVPMLIVLAVVAAIVYIVAAWRYSPNRAKELLIRIFTAITGAVSAFFLLVCAYAWLERNGAVFDLSFSFLLTALIGLAATRICRAVFLRHNPAYRIKAAKTTTPGSRVRRWRKK GT:EXON 1|1-121:0| BL:SWS:NREP 1 BL:SWS:REP 36->95|TNAB_ECO57|6e-04|30.0|60/415| TM:NTM 3 TM:REGION 6->28| TM:REGION 39->61| TM:REGION 72->94| SEG 12->27|livlavvaaivyivaa| HM:PFM:NREP 1 HM:PFM:REP 11->94|PF03208|0.00023|26.2|80/154|PRA1| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-17,20-20,25-25,31-31,39-39,45-45,53-53,67-67,73-74,76-76,81-81,87-88,90-90,95-96,101-102,104-104,121-122| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHcc //