[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54095.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:108 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   7->41 PF06072 * Herpes_US9 5.4e-05 34.3 35/60  
:BLT:SWISS 1->66 SUMF2_BOVIN 4e-04 28.8 %
:BLT:SWISS 45->86 KHSE_PROMM 2e-04 45.2 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54095.1 GT:GENE ACV54095.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(130334..130660) GB:FROM 130334 GB:TO 130660 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV54095.1 GB:DB_XREF GI:257473775 LENGTH 108 SQ:AASEQ MYHELTKQEIRRRTRKRMAGLLAIVLVVMLVWLSSNAIGASLREQGELSVRNAILNSAKQCCAIEGAYPSSLAYLEENYGLVVNRSDYAITYEVFADNVMPNVVVLAK GT:EXON 1|1-108:0| BL:SWS:NREP 2 BL:SWS:REP 1->66|SUMF2_BOVIN|4e-04|28.8|66/301| BL:SWS:REP 45->86|KHSE_PROMM|2e-04|45.2|42/316| TM:NTM 1 TM:REGION 18->40| HM:PFM:NREP 1 HM:PFM:REP 7->41|PF06072|5.4e-05|34.3|35/60|Herpes_US9| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 39-39,45-45,48-48| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHccHHHHHHHHHHHHHHHccccccccHHHHHHHcccEEEEccccEEEEEEEEccccccEEEEEc //