[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54099.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:191 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   8->76 PF01957 * NfeD 0.0002 23.5 68/144  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54099.1 GT:GENE ACV54099.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 139545..140120 GB:FROM 139545 GB:TO 140120 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV54099.1 GB:DB_XREF GI:257473779 LENGTH 191 SQ:AASEQ MKKSNVIVFVLLALASAFFLWLWYFLGLNRVDEPLDLVLSIVWWLVIVVAIAVIVKMERTRRQRVRTVYVGDCATFNSEQGLATIEGSQPVFEVIAGILQSLKYDFSRADFPDKDRFVVKYFVRTKQFEAEEKQGSDTVVDSEQASAGAAKPQIQQKTWTGEVFIVETKEERPFGSPEELARILASLEQAA GT:EXON 1|1-191:0| TM:NTM 2 TM:REGION 5->27| TM:REGION 35->57| SEG 11->26|llalasafflwlwyfl| SEG 35->55|ldlvlsivwwlvivvaiaviv| SEG 59->68|rtrrqrvrtv| HM:PFM:NREP 1 HM:PFM:REP 8->76|PF01957|0.0002|23.5|68/144|NfeD| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 25-25,31-32,34-34,39-39,67-68,73-74,76-76,79-82,87-88,90-90,95-96,101-102,104-104,109-109,143-144,146-146,151-151,165-165,191-192| PSIPRED cccccEEHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEccccccccccEEEccccccHHHHHHHHHHHHHHHHHccccccccHHHHEEEHHHHHHHHHHHccccccccccHHccccccccccccccccEEEEEEEccccccccHHHHHHHHHHHHHcc //