[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54105.1
DDBJ      :             transcriptional regulator, MarR family
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  245/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:147 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   10->142 2fbhA PDBj 1e-10 28.6 %
:RPS:PDB   9->141 2a61A PDBj 3e-21 17.3 %
:RPS:SCOP  9->141 2a61A1  a.4.5.28 * 5e-22 17.3 %
:HMM:SCOP  2->139 1jgsA_ a.4.5.28 * 1.6e-30 31.4 %
:RPS:PFM   33->90 PF01047 * MarR 3e-07 41.4 %
:HMM:PFM   33->90 PF01047 * MarR 2.1e-17 37.9 58/59  
:HMM:PFM   74->145 PF10199 * Adaptin_binding 0.00088 23.1 52/137  
:BLT:SWISS 24->139 SLYA_KLEP3 1e-15 34.5 %
:PROS 65->99|PS01117|HTH_MARR_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54105.1 GT:GENE ACV54105.1 GT:PRODUCT transcriptional regulator, MarR family GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(149762..150205) GB:FROM 149762 GB:TO 150205 GB:DIRECTION - GB:PRODUCT transcriptional regulator, MarR family GB:NOTE PFAM: regulatory protein MarR; SMART: regulatory protein MarR; KEGG: bcr:BCAH187_A3249 transcriptional regulator, MarR family GB:PROTEIN_ID ACV54105.1 GB:DB_XREF GI:257473785 InterPro:IPR000835 LENGTH 147 SQ:AASEQ MINQHNSLIGFLVYDAQRAIAKSLETALKPYEITPGQWNLINQLDSAGELSQKQLAERTRKEQATITRYLDTLERKGLVVRNQHKSDRRAHAISVTDKAHELVMAAQPVTVDAADRLIEGIDQADLDTFVAVLAKLKENADNYSNNG GT:EXON 1|1-147:0| BL:SWS:NREP 1 BL:SWS:REP 24->139|SLYA_KLEP3|1e-15|34.5|116/144| PROS 65->99|PS01117|HTH_MARR_1|PDOC00861| BL:PDB:NREP 1 BL:PDB:REP 10->142|2fbhA|1e-10|28.6|133/137| RP:PDB:NREP 1 RP:PDB:REP 9->141|2a61A|3e-21|17.3|133/142| RP:PFM:NREP 1 RP:PFM:REP 33->90|PF01047|3e-07|41.4|58/59|MarR| HM:PFM:NREP 2 HM:PFM:REP 33->90|PF01047|2.1e-17|37.9|58/59|MarR| HM:PFM:REP 74->145|PF10199|0.00088|23.1|52/137|Adaptin_binding| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01047|IPR000835| GO:PFM GO:0005622|"GO:intracellular"|PF01047|IPR000835| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01047|IPR000835| RP:SCP:NREP 1 RP:SCP:REP 9->141|2a61A1|5e-22|17.3|133/139|a.4.5.28| HM:SCP:REP 2->139|1jgsA_|1.6e-30|31.4|137/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 310 OP:NHOMOORG 249 OP:PATTERN ---------------------------------1----------------1-1--------------- ----1----------------1-------------1--------------------1---------2-------------1-------1111---------------1-----------------1----1---11----------------------------1---11--------------1--------1222221-3-2221-11---1-21------1-12222142-------1----------------------------------------------1-------------------------------------2-1-------2-2--11--11-2--------321211-----------1--1------------1---1--------------1---------11--31112212231----1-----1-----11111111----1122--------------------------------21-----12233211----2211-----1312-1-1----1-----1---1--11----------1-1---1---2-1-----2-11--1312--112-----------------------------1-------1-1---11-11111---21-21---2--1-1----------11111111111111111-111111111111111111111111111-1-1----1111-11111111111111111111111-1111--1--1------11--------------------------------1-1-----1-111-----------111-----1------------------------11--------------------------------------2------------ -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 146 STR:RPRED 99.3 SQ:SECSTR ccccccTTHHHHHHHHHHHHHHHHHTTHHHHTccHHHHHHHHHHHHHccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEETTEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHccTHH# PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccc //