[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54109.1
DDBJ      :             cytoplasmic chaperone TorD family protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  22/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.184.1
:225 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   97->220 1n1cB PDBj 1e-06 36.0 %
:RPS:PDB   82->223 3efpB PDBj 2e-19 24.0 %
:RPS:SCOP  82->223 1n1cA  a.184.1.1 * 9e-19 29.4 %
:HMM:SCOP  14->222 1n1cA_ a.184.1.1 * 9.3e-38 42.3 %
:RPS:PFM   99->185 PF02613 * Nitrate_red_del 1e-09 45.6 %
:HMM:PFM   53->192 PF02613 * Nitrate_red_del 6.4e-29 40.5 121/136  
:BLT:SWISS 97->220 TORD_PHOPR 4e-15 37.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54109.1 GT:GENE ACV54109.1 GT:PRODUCT cytoplasmic chaperone TorD family protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 155600..156277 GB:FROM 155600 GB:TO 156277 GB:DIRECTION + GB:PRODUCT cytoplasmic chaperone TorD family protein GB:NOTE PFAM: cytoplasmic chaperone TorD family protein; KEGG: glo:Glov_1147 cytoplasmic chaperone TorD family protein GB:PROTEIN_ID ACV54109.1 GB:DB_XREF GI:257473789 InterPro:IPR010395 LENGTH 225 SQ:AASEQ MIETMPAELAENLIDFCENRDRVYALLSRCYETEIDAAFAEALAGEAALASDDAGLAAGFAALQADLADCDEDALEQLAVVFDRAFFGMGPRTAQKAFPYESVYTSEGGLMMQEAYAEVLHVYRGAGFAKNPGFKEPEDHLAVELAFMALLCGRAVEALRAGDEAGAERQLRAQREFLSDHLLNWIDRFTADVRKAAEDGFYFDLATFTEDFLTADAAELAEVLG GT:EXON 1|1-225:0| BL:SWS:NREP 1 BL:SWS:REP 97->220|TORD_PHOPR|4e-15|37.2|121/216| SEG 36->79|daafaealageaalasddaglaagfaalqadladcdedaleqla| BL:PDB:NREP 1 BL:PDB:REP 97->220|1n1cB|1e-06|36.0|100/195| RP:PDB:NREP 1 RP:PDB:REP 82->223|3efpB|2e-19|24.0|125/208| RP:PFM:NREP 1 RP:PFM:REP 99->185|PF02613|1e-09|45.6|79/148|Nitrate_red_del| HM:PFM:NREP 1 HM:PFM:REP 53->192|PF02613|6.4e-29|40.5|121/136|Nitrate_red_del| GO:PFM:NREP 1 GO:PFM GO:0009325|"GO:nitrate reductase complex"|PF02613|IPR003765| RP:SCP:NREP 1 RP:SCP:REP 82->223|1n1cA|9e-19|29.4|119/199|a.184.1.1| HM:SCP:REP 14->222|1n1cA_|9.3e-38|42.3|189/207|a.184.1.1|1/1|TorD-like| OP:NHOMO 58 OP:NHOMOORG 23 OP:PATTERN ------------------------1------------------------------------------- ---------------------------------------------------------------1----------------88---111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------21-------------------------2----9A-----1-2----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------1--1---------------------------------11------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-----11---------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 130 STR:RPRED 57.8 SQ:SECSTR #################################################################################HHHHHTccccccc##ccccHHHHHcTTccTTcHHHHHHHHHHHHTTccccccTTccTTcHHHHHHHHHHHHHTT###########HTTcHHHHHHHHHHHTHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHTTccccc# PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccccccccHHHccccHHHHccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHc //