[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54110.1
DDBJ      :             4Fe-4S ferredoxin iron-sulfur binding domain protein
Swiss-Prot:             

Homologs  Archaea  14/68 : Bacteria  198/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.1
:247 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   55->116 1kqfB PDBj 2e-04 37.3 %
:BLT:PDB   94->147 2o01C PDBj 8e-05 43.8 %
:BLT:PDB   122->189 1b0vA PDBj 4e-07 38.7 %
:RPS:PDB   78->176 1d0cB PDBj 6e-07 10.1 %
:RPS:SCOP  55->116 2fug91  d.58.1.5 * 1e-07 30.6 %
:RPS:SCOP  94->185 1hfeL2  d.58.1.5 * 3e-09 19.5 %
:HMM:SCOP  55->182 1h0hB_ d.58.1.5 * 1e-15 33.9 %
:HMM:PFM   54->70 PF00037 * Fer4 2.1e-06 41.2 17/24  
:HMM:PFM   89->109 PF00037 * Fer4 2.1e-08 42.9 21/24  
:HMM:PFM   158->177 PF00037 * Fer4 2.3e-09 50.0 20/24  
:HMM:PFM   7->30 PF10518 * TAT_signal 9.6e-07 50.0 24/26  
:BLT:SWISS 36->175 MAUM_PARDP 2e-24 43.2 %
:PROS 55->66|PS00198|4FE4S_FER_1
:PROS 94->105|PS00198|4FE4S_FER_1
:PROS 165->176|PS00198|4FE4S_FER_1
:REPEAT 3|55->68|94->107|165->178
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54110.1 GT:GENE ACV54110.1 GT:PRODUCT 4Fe-4S ferredoxin iron-sulfur binding domain protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 156486..157229 GB:FROM 156486 GB:TO 157229 GB:DIRECTION + GB:PRODUCT 4Fe-4S ferredoxin iron-sulfur binding domain protein GB:NOTE PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain protein; KEGG: bpt:Bpet4080 quinol dehydrogenase periplasmic component GB:PROTEIN_ID ACV54110.1 GB:DB_XREF GI:257473790 InterPro:IPR001450 InterPro:IPR006311 InterPro:IPR017900 LENGTH 247 SQ:AASEQ MISVETISRRGFLAAGAVGAAMVGVGGFGAVSRQADAAFVRPPGAESNAQLVAACDRCGRCLQACPYGIVTPVPLAENLVAYGTPTLAFDHGCCDFCMQCVDACPTGALAYGGPRERDLGVAVVVKDACVAWDWAGCTVCKDECPVEGAITLDDHDRPVVHPEYCDGCGKCEQVCPSASLRAYDASVEDKGIVVVSRSSEAAQATGAVSSEELASKRTVAVAQANAASPHTKGVHPDGPDATREAGA GT:EXON 1|1-247:0| BL:SWS:NREP 1 BL:SWS:REP 36->175|MAUM_PARDP|2e-24|43.2|139/224| PROS 55->66|PS00198|4FE4S_FER_1|PDOC00176| PROS 94->105|PS00198|4FE4S_FER_1|PDOC00176| PROS 165->176|PS00198|4FE4S_FER_1|PDOC00176| NREPEAT 1 REPEAT 3|55->68|94->107|165->178| SEG 14->31|aagavgaamvgvggfgav| BL:PDB:NREP 3 BL:PDB:REP 55->116|1kqfB|2e-04|37.3|59/289| BL:PDB:REP 94->147|2o01C|8e-05|43.8|48/80| BL:PDB:REP 122->189|1b0vA|4e-07|38.7|62/106| RP:PDB:NREP 1 RP:PDB:REP 78->176|1d0cB|6e-07|10.1|99/414| HM:PFM:NREP 4 HM:PFM:REP 54->70|PF00037|2.1e-06|41.2|17/24|Fer4| HM:PFM:REP 89->109|PF00037|2.1e-08|42.9|21/24|Fer4| HM:PFM:REP 158->177|PF00037|2.3e-09|50.0|20/24|Fer4| HM:PFM:REP 7->30|PF10518|9.6e-07|50.0|24/26|TAT_signal| RP:SCP:NREP 2 RP:SCP:REP 55->116|2fug91|1e-07|30.6|62/154|d.58.1.5| RP:SCP:REP 94->185|1hfeL2|3e-09|19.5|82/85|d.58.1.5| HM:SCP:REP 55->182|1h0hB_|1e-15|33.9|118/214|d.58.1.5|1/1|4Fe-4S ferredoxins| OP:NHOMO 373 OP:NHOMOORG 212 OP:PATTERN ---1-1----------1---------------413-2-33322---1------1-------------- --------------------------------------------------------------------------------75---2-21121-3--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1-----------2----22-----1----------------------------------------------1---1--------11---1---11-----2-113------------------31----------------------------------------1---------------------------------1------------3-11--2-----------13-121-21-11---1-1112-2--------111212111111-1-1-------33223--33--------12111111212222221221-------------1---3--2222222222-2222222212222222223---22---2222222212222221-2222212--122222222222------------------333312132331113-------------1-1-----------------------11141111123112----------------3-111111-----------------------------------------------11 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 148 STR:RPRED 59.9 SQ:SECSTR ##########################################cTEEEEccGGGGccccccccTTcccTTccccTTTcEEEcTTTccEEEccGGGGccccccccTTcccTTcccccccccccccHHHHHHHHHHHHHHHHTTcTTcHHHHHHHHHHHHHHHccccccHHHHHHHHHHTccEEEccGccGGH######################################################### DISOP:02AL 246-248| PSIPRED cccEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHcccccHHHHHcccccEEEEEcccccccccccEEEEEcccccccccHHHHcccccccccccccccccccccccHHHHHcccccHHHHHHHccccEEEEEcccccEEEcHHHccccccHHHHcccccEEEEcccccccccEEEcccccccccccccccccccccccEEEccccccccccccccccccccHHHccc //