[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54123.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:73 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   12->62 PF11143 * DUF2919 0.00024 23.5 51/149  
:PROS 1->4|PS00228|TUBULIN_B_AUTOREG
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54123.1 GT:GENE ACV54123.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 175484..175705 GB:FROM 175484 GB:TO 175705 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV54123.1 GB:DB_XREF GI:257473803 InterPro:IPR013838 LENGTH 73 SQ:AASEQ MREISGLAKFGYFCVGLFGGLFGVLAAWFMGKDGWGWSEGGKLFAWFGCLFWLIVWVVMVVTGGIAAFLGMLF GT:EXON 1|1-73:0| PROS 1->4|PS00228|TUBULIN_B_AUTOREG|PDOC00200| TM:NTM 2 TM:REGION 9->31| TM:REGION 46->68| SEG 10->25|fgyfcvglfgglfgvl| HM:PFM:NREP 1 HM:PFM:REP 12->62|PF11143|0.00024|23.5|51/149|DUF2919| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 25-26,31-32,34-34,39-39| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //