[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54132.1
DDBJ      :             Rubrerythrin
Swiss-Prot:             

Homologs  Archaea  40/68 : Bacteria  177/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.25.1g.41.5
:263 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   68->263 1yuxB PDBj 5e-68 60.2 %
:RPS:PDB   89->260 1b71A PDBj 5e-14 33.3 %
:RPS:SCOP  74->227 1yuxA1  a.25.1.1 * 1e-38 65.1 %
:RPS:SCOP  233->260 1b71A2  g.41.5.1 * 7e-04 35.7 %
:HMM:SCOP  62->227 1yv1A1 a.25.1.1 * 1.6e-22 24.7 %
:HMM:SCOP  228->264 1nnqA2 g.41.5.1 * 8.5e-06 43.2 %
:RPS:PFM   93->213 PF02915 * Rubrerythrin 1e-07 36.7 %
:HMM:PFM   92->220 PF02915 * Rubrerythrin 2.4e-27 30.5 128/137  
:HMM:PFM   4->28 PF10518 * TAT_signal 7.8e-05 44.0 25/26  
:HMM:PFM   234->257 PF02132 * RecR 0.00099 33.3 21/41  
:BLT:SWISS 68->263 NIGY_DESVH 2e-67 60.2 %
:REPEAT 2|93->149|168->225

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54132.1 GT:GENE ACV54132.1 GT:PRODUCT Rubrerythrin GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(191120..191911) GB:FROM 191120 GB:TO 191911 GB:DIRECTION - GB:PRODUCT Rubrerythrin GB:NOTE PFAM: Rubrerythrin; Rubredoxin-type Fe(Cys)4 protein; KEGG: dvl:Dvul_2946 rubrerythrin GB:PROTEIN_ID ACV54132.1 GB:DB_XREF GI:257473812 InterPro:IPR003251 InterPro:IPR004039 InterPro:IPR006311 InterPro:IPR009040 LENGTH 263 SQ:AASEQ MSDISRRNLLKGAAVSAVSISAMGLLGACAAPSEPKAETTTDPSADGTGTGSGTNSEYMAEVLEPTSMPDASTASNFNIIYDSKTTVGTTYENLMTAIAGETGATTKYEAFSKVAKNEGFDVLARLFQCTADAEKIHIGLEYDLAKEIDPATEKPEPPAVEEHESDINLISGANGEIYETSDMYPSFIKKAQEEGNNKAVQVFTRAKLAEAYHAKLYMDAYTTIDTPFDGKYYLCPICGYIHKGENFTACPICLAPKSSFTAY GT:EXON 1|1-263:0| BL:SWS:NREP 1 BL:SWS:REP 68->263|NIGY_DESVH|2e-67|60.2|196/202| NREPEAT 1 REPEAT 2|93->149|168->225| BL:PDB:NREP 1 BL:PDB:REP 68->263|1yuxB|5e-68|60.2|196/202| RP:PDB:NREP 1 RP:PDB:REP 89->260|1b71A|5e-14|33.3|171/191| RP:PFM:NREP 1 RP:PFM:REP 93->213|PF02915|1e-07|36.7|120/135|Rubrerythrin| HM:PFM:NREP 3 HM:PFM:REP 92->220|PF02915|2.4e-27|30.5|128/137|Rubrerythrin| HM:PFM:REP 4->28|PF10518|7.8e-05|44.0|25/26|TAT_signal| HM:PFM:REP 234->257|PF02132|0.00099|33.3|21/41|RecR| GO:PFM:NREP 1 GO:PFM GO:0046872|"GO:metal ion binding"|PF02915|IPR003251| RP:SCP:NREP 2 RP:SCP:REP 74->227|1yuxA1|1e-38|65.1|152/164|a.25.1.1| RP:SCP:REP 233->260|1b71A2|7e-04|35.7|28/44|g.41.5.1| HM:SCP:REP 62->227|1yv1A1|1.6e-22|24.7|166/0|a.25.1.1|1/1|Ferritin-like| HM:SCP:REP 228->264|1nnqA2|8.5e-06|43.2|37/0|g.41.5.1|1/1|Rubredoxin-like| OP:NHOMO 311 OP:NHOMOORG 218 OP:PATTERN ----1-11111111111------4--------112111111112231212222-11--111---1--- -1---------------------------------------111----------------------------------1122--1---1111--11-----------------------------11112211111-----111----1-11---111-11------111--------1---------111------------------------------------------------------------------------------------------------------------------------------------23422111111131322221344222121--113331-11121111211--1---------------------------------------------1-----------------------------------------1-------------------------------1----------111111-111111-11111-11-------1---11-----11-----1--------------11---333122322233311212222222222-122-1--1111111---------11--2--------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------15--------------1---------------------------1111111111--2 -------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 196 STR:RPRED 74.5 SQ:SECSTR ###################################################################cccTTcTTcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcHHHHHHHHHHHHHHHHHHHHHHTTcccccccccccccccccccHHHHHHHHHHHHHHHHHHTHHHHHHHHHHTTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEETTTccEEEEEcccccTTTcccGGGEEEc DISOP:02AL 25-25| PSIPRED cccHHHHHHHHHccHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEccccccEEEcccccccccccccHHHHccc //