[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54136.1
DDBJ      :             hydrogenase expression/formation protein HypD
Swiss-Prot:             

Homologs  Archaea  40/68 : Bacteria  293/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:393 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   39->392 2z1dB PDBj 5e-80 45.0 %
:RPS:PDB   102->321 2dhhA PDBj 3e-04 17.5 %
:RPS:PFM   42->392 PF01924 * HypD e-115 57.8 %
:HMM:PFM   42->392 PF01924 * HypD 1.6e-147 53.6 351/356  
:BLT:SWISS 40->392 HYPD_RHOCA 2e-91 49.6 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54136.1 GT:GENE ACV54136.1 GT:PRODUCT hydrogenase expression/formation protein HypD GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 196976..198157 GB:FROM 196976 GB:TO 198157 GB:DIRECTION + GB:PRODUCT hydrogenase expression/formation protein HypD GB:NOTE TIGRFAM: hydrogenase expression/formation protein HypD; PFAM: hydrogenase formation HypD protein; KEGG: sfu:Sfum_4014 hydrogenase expression/formation protein HypD GB:PROTEIN_ID ACV54136.1 GB:DB_XREF GI:257473816 InterPro:IPR002780 LENGTH 393 SQ:AASEQ MTSSTGTDVSRETSVEPKDRPEHLARAVDAATMESELAAFKDPKLARGLIESIAKLSPAGGATLMEVCGTHTVAIARNGIRNLMPEGTRLASGPGCPVCVTSNRDIDTVIALARVPGITIATFGDMTRVPGSTSSLLAEQAAGRSVQIVYSPLDALTLAQQNPDREIVFVGVGFETTTPLVAMAIKRAAAAGLKNFSVFGAHKNMPGALEAIINDPQLKVDALILPGHVSTIIGAEPYRFLAEKYGIPGVITGFEPVDVLQGIAMIMRQLHEGRADIEIAYARGVMPEGNPVALAAIDEVFETCTALWRGLGEIPGSGYRIREEFAQFDAVRRFQPDVEPTQDPKGCRCGDVLRGIMAPNECPLFRKVCTPENPVGPCMVSSEGSCAAYHRYY GT:EXON 1|1-393:0| BL:SWS:NREP 1 BL:SWS:REP 40->392|HYPD_RHOCA|2e-91|49.6|353/377| BL:PDB:NREP 1 BL:PDB:REP 39->392|2z1dB|5e-80|45.0|351/367| RP:PDB:NREP 1 RP:PDB:REP 102->321|2dhhA|3e-04|17.5|189/1022| RP:PFM:NREP 1 RP:PFM:REP 42->392|PF01924|e-115|57.8|351/355|HypD| HM:PFM:NREP 1 HM:PFM:REP 42->392|PF01924|1.6e-147|53.6|351/356|HypD| GO:PFM:NREP 1 GO:PFM GO:0046872|"GO:metal ion binding"|PF01924|IPR002780| OP:NHOMO 352 OP:NHOMOORG 333 OP:PATTERN --11111---------1--11111-----1--1111111111111111--11111111121---1--- 112---1--------------1--12------2111-111-222---------------------111-----------11111111------1-------1--1--------------------111111-111111111111-11111111--11------11--1111-----------------111------------------------------------------------------------------------------------------------------------------------------------1--1111111111-11-------1-1-----1111--1-1-11--111--11----------12213---121-1------------------------------------11-----11111-----------1----1-1---------------------------------1--------------------1-------11--22-----11----1-1----11--------------1-11-11-211111111111111111-11111-11111111111111111111111111112211-1------111111-111111111111-----1-1------111111-1111111111-11111111111111111111111---1111111111111111111111111--1--------------------11111-1--111111-------------------1------------------1--------1------------------------------2--------------------------------------------1--------111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 352 STR:RPRED 89.6 SQ:SECSTR ######################################HHHHHHHHHHHHHHHHHHHTTccEEEEEc#HHHHHHHHHTTHHHHccTTEEEEEccccTTTTcGGGcHHHHHHTcccTTcccEEEcccTTcccccccHHHHHHTcEEEEEETTHHHHHHHHHccGGGEccccEEcccccEEcccccccHHHHHTccHHHHHEEEEccHHHHHHHHHTTcccccEEEccccEEEccccGGGcccTTTGGEEcTTccEEEGGGcEEccEEEEETTEEEEEEEEcccccccHHHcHHHHHHHHHHEEEEEEEETTHHTccETTcEEcGGGGGGc#GGGTccccccccccTTccHHHHHHTcccGGGcTTcTTTccccccccHHHHcTTcHHHHHHHT# DISOP:02AL 17-20,23-28,31-32| PSIPRED ccccccccccccccccccccHHHHHHHHHHHHcHHHHHHcccHHHHHHHHHHHHHHcccccEEEEEEEccccHHHHHHcHHHHccccEEEEEcccccEEEccHHHHHHHHHHHHcccEEEEEEHHHHccccccccHHHHHcccccEEEEEcHHHHHHHHHHccccEEEEEEEccHHHHHHHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHcccccEEEEEEccEEEEEEccHHHHHHHHHccccEEEEcccHHHHHHHHHHHHHHHHcccEEEEEEEEEEEcHHHcHHHHHHHHHHcccccccccccEEccccHHEEcHHHHHccHHHHccccccccccccccccHHHHccccccccccccccccccccccccccccccHHHHHHHccc //