[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54149.1
DDBJ      :             aminotransferase class I and II
Swiss-Prot:             

Homologs  Archaea  65/68 : Bacteria  834/915 : Eukaryota  176/199 : Viruses  0/175   --->[See Alignment]
c.67.1
:372 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   51->364 1o4sB PDBj 8e-25 28.4 %
:RPS:PDB   49->368 5bj4A PDBj 1e-35 22.9 %
:RPS:SCOP  2->371 2gb3A1  c.67.1.1 * 3e-32 18.2 %
:HMM:SCOP  1->372 1iayA_ c.67.1.4 * 4.2e-86 29.5 %
:RPS:PFM   56->364 PF00155 * Aminotran_1_2 1e-23 31.0 %
:HMM:PFM   54->363 PF00155 * Aminotran_1_2 9.2e-44 20.9 306/363  
:BLT:SWISS 51->364 AAT_THEMA 2e-24 28.4 %
:PROS 219->232|PS00105|AA_TRANSFER_CLASS_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54149.1 GT:GENE ACV54149.1 GT:PRODUCT aminotransferase class I and II GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(216296..217414) GB:FROM 216296 GB:TO 217414 GB:DIRECTION - GB:PRODUCT aminotransferase class I and II GB:NOTE PFAM: aminotransferase class I and II; aminotransferase class V; aromatic amino acid beta- eliminating lyase/threonine aldolase; KEGG: bph:Bphy_4257 aminotransferase class I and II GB:PROTEIN_ID ACV54149.1 GB:DB_XREF GI:257473829 InterPro:IPR000192 InterPro:IPR001176 InterPro:IPR001597 InterPro:IPR004838 InterPro:IPR004839 LENGTH 372 SQ:AASEQ MHIATIGVEDWLNVWEKSATYDIAQSTISSMTMGEILALDDEQGATFYERLNKEKMNYGWIEGSPAFKEEVAKLYRSADPDNVLQTNGATGANLLALLALVEPGDHVIAEYPTYQPLYEIPRTLGADVEYWHIRREHGWNPDVTELEKLVRPDTKLICINNASNPLGTVLDAATLKRIAEIAESVGAYVLSDEVYLPLHDTESYVSMADLYDRAIVTNSLSKTYSVPGARIGWTVSNKELADRFRVYRDYTMICDGVFNDALAVHVLRNRDKVLERNRAIVTNNLAIAQEWVDNEPRVSWVPPKAVSTSFIELDIPIDDERFCIDLLRDQGVLLVPGSRFELPCGARLGYCAPDPTLREGLKRLSAALRQFD GT:EXON 1|1-372:0| BL:SWS:NREP 1 BL:SWS:REP 51->364|AAT_THEMA|2e-24|28.4|303/377| PROS 219->232|PS00105|AA_TRANSFER_CLASS_1|PDOC00098| SEG 86->100|tngatganllallal| BL:PDB:NREP 1 BL:PDB:REP 51->364|1o4sB|8e-25|28.4|303/384| RP:PDB:NREP 1 RP:PDB:REP 49->368|5bj4A|1e-35|22.9|319/366| RP:PFM:NREP 1 RP:PFM:REP 56->364|PF00155|1e-23|31.0|303/341|Aminotran_1_2| HM:PFM:NREP 1 HM:PFM:REP 54->363|PF00155|9.2e-44|20.9|306/363|Aminotran_1_2| GO:PFM:NREP 3 GO:PFM GO:0009058|"GO:biosynthetic process"|PF00155|IPR004839| GO:PFM GO:0016769|"GO:transferase activity, transferring nitrogenous groups"|PF00155|IPR004839| GO:PFM GO:0030170|"GO:pyridoxal phosphate binding"|PF00155|IPR004839| RP:SCP:NREP 1 RP:SCP:REP 2->371|2gb3A1|3e-32|18.2|369/389|c.67.1.1| HM:SCP:REP 1->372|1iayA_|4.2e-86|29.5|369/428|c.67.1.4|1/1|PLP-dependent transferases| OP:NHOMO 3144 OP:NHOMOORG 1075 OP:PATTERN 333232143333334346353436344433551-1231535326544445566-44354462343-22 4682632444413123322-2211212122223333453513344231222176633411333-433554235556663324142332226224--1--12335623632---------------22232212123344433343343244432222111111232333461111111111111222211154466666667456666513444465556522343333346423333333333333221132421133191314455441313624442223233344333323333332222222222222443444444437365777776747635554333324-2153325425521333334221232-222211111315452323443322222222226-2263243369415444437333465524124232336363333333341143554-111111111111111111111111111121351215322667566623335577333334546343412458543442233722322422132222222222333-7421356264553-2323114232212524422111111111121111111212222211-22211311-31111112111-211122---45341--11112331333443333322-4332422233423333333111222212222122222222222321422221-322232223333-11------333336245222123-2211222222222231123277675754355544334532324323311121111111112332323322311111131443344------------------------------------5224422232234 ----223-421-33211221232515311----22313333331121234264432222222122112211221211-1113231211--311-1-111211-222-2433474747-231242A311-463-425212251174213213324243261-22553-522244133214U343-4567I2A23593874 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 372 STR:RPRED 100.0 SQ:SECSTR HHHHTccccHHHHHHHHHHHHHHTTcccEEccccccccccHHHHHHHHHHHHTTccccccTTccHHHHHHHHHHHHHTcGGGEEEEcHHHHHHHHHHHHHccTTcEEEEEEcccTHHHHHHHHTTcEEEEEEccGGGTTcccHHHHHTTccTTEEEEEEEcccTTTcccccHHHHHHHHHHHHHHTcEEEEEcTTTTccccccccGGGTcTTTEEEEEEcTTTTTcGGGccEEEEccHHHHHHHHHHHHTTTccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHTHHHTccccccccTTEEEEEcTTTcccHHHHHHHHHHTTEEcEEcGGGTcTTEEEEEccccHHHHHHHHHHGGGGcHHHc DISOP:02AL 372-373| PSIPRED ccccccHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccHHHEEEcccHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHcccEEEEEEcccHHcccccHHHHHHHcccccEEEEEccccccccccccHHHHHHHHHHHHHcccEEEEEccccHHccccccccHHHHcccEEEEcccHHHccccccEEEEEEccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEccccEEEEEEEccccccHHHHHHHHHHHccEEEEcccccccccEEEEEEEccHHHHHHHHHHHHHHHHHHc //