[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54158.1
DDBJ      :             4Fe-4S ferredoxin iron-sulfur binding domain protein
Swiss-Prot:             

Homologs  Archaea  55/68 : Bacteria  512/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.58.1
:188 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->188 2vpyB PDBj 4e-27 38.2 %
:RPS:PDB   62->163 1a6lA PDBj 1e-12 18.0 %
:RPS:SCOP  4->188 1ti2B2  d.58.1.5 * 6e-50 32.0 %
:HMM:SCOP  1->188 1q16B_ d.58.1.5 * 2.6e-70 45.3 %
:HMM:PFM   9->25 PF00037 * Fer4 8.8e-05 47.1 17/24  
:HMM:PFM   94->115 PF00037 * Fer4 1.5e-10 45.5 22/24  
:BLT:SWISS 4->188 NRFC_HAEIN 3e-38 42.5 %
:PROS 100->111|PS00198|4FE4S_FER_1
:REPEAT 2|105->140|141->177

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54158.1 GT:GENE ACV54158.1 GT:PRODUCT 4Fe-4S ferredoxin iron-sulfur binding domain protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 229806..230372 GB:FROM 229806 GB:TO 230372 GB:DIRECTION + GB:PRODUCT 4Fe-4S ferredoxin iron-sulfur binding domain protein GB:NOTE PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain protein; KEGG: vha:VIBHAR_02586 hypothetical protein GB:PROTEIN_ID ACV54158.1 GB:DB_XREF GI:257473838 InterPro:IPR001450 InterPro:IPR017900 LENGTH 188 SQ:AASEQ MTEKRYGMVIDTQHCVGCQTCTVSCKISNEVPGSAHWNHLESLDGDVLYQSTGTFPRTTLAFRPLLCNHCENPACVNNCPSGAMHKDPATGIVSVNQDVCIACGYCSWVCPYGAPSMNDVDHVMSKCTFCAERVAEGVEPYCVAACPANARVFGDLNDPESAPSKLMQERHAEPYLPEAGTHPSVYYI GT:EXON 1|1-188:0| BL:SWS:NREP 1 BL:SWS:REP 4->188|NRFC_HAEIN|3e-38|42.5|179/225| PROS 100->111|PS00198|4FE4S_FER_1|PDOC00176| NREPEAT 1 REPEAT 2|105->140|141->177| BL:PDB:NREP 1 BL:PDB:REP 5->188|2vpyB|4e-27|38.2|173/193| RP:PDB:NREP 1 RP:PDB:REP 62->163|1a6lA|1e-12|18.0|100/106| HM:PFM:NREP 2 HM:PFM:REP 9->25|PF00037|8.8e-05|47.1|17/24|Fer4| HM:PFM:REP 94->115|PF00037|1.5e-10|45.5|22/24|Fer4| RP:SCP:NREP 1 RP:SCP:REP 4->188|1ti2B2|6e-50|32.0|181/195|d.58.1.5| HM:SCP:REP 1->188|1q16B_|2.6e-70|45.3|181/509|d.58.1.5|1/1|4Fe-4S ferredoxins| OP:NHOMO 2517 OP:NHOMOORG 570 OP:PATTERN 22121322344333325-5574473113-1131-423333233-1--13-21112115261---4--- -7A11111111--1-2211-11--1211111-12221-111---11211-----11----2122112-31---------6cS334222-----------------1-11----------------2243333332344411333-4----------------------------------------211----1111111-111111111-11-1111--2---1------1-1111111111111111111--------1---11-1-------------------------------------------------------133-11111111-1-1411-111--1--9--13pl3355-5AB1113----731--1------21--423-32--11111111112-2242232411----------1-1121-11212-1--31211111111311--8-4-------------------------------111-122-3211212233333323444413222334211232241443325213124-1-23----------B3418D648CC8DAAAE188797693-BABA353627422112211-2-------2B3321174-111-----46997-5H9A9787BA8J8---1842------B5D9AA-HIIGHGFFHH-HHGIHGGHGHIGHFHHHHA8AA9621CHEGGHHHHHHGFHFGG7ACBFEFG--555555545555---1---------1112-444444133232114-------1-12-22221-1--11114-------------2333111114422322------------123-111111-------------------------------------11--11111131 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------------------------3---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 188 STR:RPRED 100.0 SQ:SECSTR cccccHTTccccTTTccccccccccHHHHHHHHHHHHHHHHHHTTcTTcHHHHHHHHHHHHEEcGGGTTTcccHHHHHcTTccEEEcccTccEEEcTTTcccccccTTTcTTccEEEGGGccGGGTHHHHHHHHHHTTcccccccccccTTHHHHTTcccGGGccHHHHHcccEEEEcTTcccEEEcc DISOP:02AL 188-189| PSIPRED ccccEEEEEEEHHHcccccHHHHHHHHHccccccccccEEEEEcccEEEEEEEcccccEEEEEEEccccccccHHHHHccccccEEccccccEEccHHHcccccccHHccccccEEEcccccEEEEEcccHHHHHcccccEEHHHcccccEEEEEHHHHHHHHHHHHHHcccEEccHHHcccccEEEc //