[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54166.1
DDBJ      :             fumarate reductase/succinate dehydrogenase flavoprotein domain protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  165/915 : Eukaryota  15/199 : Viruses  0/175   --->[See Alignment]
c.3.1d.168.1
:560 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   59->554 1qo8A PDBj 1e-30 30.4 %
:RPS:PDB   53->98 2dkhA PDBj 1e-04 23.9 %
:RPS:PDB   69->559 1e39A PDBj 1e-32 22.2 %
:RPS:SCOP  68->364 1d4cA2  c.3.1.4 * 3e-18 25.4 %
:RPS:SCOP  349->496 1d4cA3  d.168.1.1 * 9e-17 26.9 %
:HMM:SCOP  47->559 1jnrA2 c.3.1.4 * 1.7e-36 26.6 %
:RPS:PFM   69->373 PF00890 * FAD_binding_2 4e-22 35.7 %
:HMM:PFM   70->536 PF00890 * FAD_binding_2 8e-48 27.2 378/421  
:BLT:SWISS 59->554 FRD2_SHEFN 3e-30 30.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54166.1 GT:GENE ACV54166.1 GT:PRODUCT fumarate reductase/succinate dehydrogenase flavoprotein domain protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 239657..241339 GB:FROM 239657 GB:TO 241339 GB:DIRECTION + GB:PRODUCT fumarate reductase/succinate dehydrogenase flavoprotein domain protein GB:NOTE PFAM: fumarate reductase/succinate dehydrogenase flavoprotein domain protein; FAD dependent oxidoreductase; KEGG: sbm:Shew185_1157 fumarate reductase/succinate dehydrogenase flavoprotein domain-containing protein GB:PROTEIN_ID ACV54166.1 GB:DB_XREF GI:257473846 InterPro:IPR003953 InterPro:IPR006076 InterPro:IPR006311 LENGTH 560 SQ:AASEQ MTKATKGLSRRAFLGLGATAAALAGAGLAGCAPSAAPTKDEEAAAAVNDWLGAEPEIPEDKIVETIDTEILVCGAGTSGLFAACSAAEEGAKVVCLEKAAIGGGVRDNLGSLNSRLQKEAGCEIDENEICNDLMRYADGYCNPRLYHIWAQNSGEAIDWYQDRLEEAGFQLFFEAANDAKPSIYKHWATGHIPSWPADAEFAGLKDVTNGKIVLGDYAKKVGVDFRFTTPLVKLVHENGKVTGAIAKGSDGYIKINASKGTVVCTGGYARNEDMLKALQPQTLNKYSLSIAIDGTTGDGIKSCLWAGARMDEVHTAMVFDRVAVKPDEFGGAQTTGSLFWMGSNPWLKVNLNGERFANESGPYDYILNAALTQPNHTVVDIWDSDYETYLEQFDIHGCARVYPFENGAPTNMTLETVKGINEGLLADGYIVKADTIEELAKGLGLPVENLKKTVDRQNENYDNQVDPDFGKEAFRLSPVRKAPFYGVRTSGYMLCTLDGITINENFQAVNEEGEAIEGLYVTGVDSGSYYAHTYPNMSTGNCCGRSVTFARMIGKALAAK GT:EXON 1|1-560:0| BL:SWS:NREP 1 BL:SWS:REP 59->554|FRD2_SHEFN|3e-30|30.4|438/588| SEG 12->36|aflglgataaalagaglagcapsaa| SEG 41->46|eeaaaa| BL:PDB:NREP 1 BL:PDB:REP 59->554|1qo8A|1e-30|30.4|438/564| RP:PDB:NREP 2 RP:PDB:REP 53->98|2dkhA|1e-04|23.9|46/614| RP:PDB:REP 69->559|1e39A|1e-32|22.2|437/568| RP:PFM:NREP 1 RP:PFM:REP 69->373|PF00890|4e-22|35.7|272/375|FAD_binding_2| HM:PFM:NREP 1 HM:PFM:REP 70->536|PF00890|8e-48|27.2|378/421|FAD_binding_2| GO:PFM:NREP 2 GO:PFM GO:0009055|"GO:electron carrier activity"|PF00890|IPR003953| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00890|IPR003953| RP:SCP:NREP 2 RP:SCP:REP 68->364|1d4cA2|3e-18|25.4|279/322|c.3.1.4| RP:SCP:REP 349->496|1d4cA3|9e-17|26.9|119/146|d.168.1.1| HM:SCP:REP 47->559|1jnrA2|1.7e-36|26.6|304/357|c.3.1.4|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 479 OP:NHOMOORG 181 OP:PATTERN ------------------------------1------------------------------------- --------225---24511-14--3411111334343876-1-3----1-----1-----224----1-----------AnG-------------------------------------------------------11--------------------------------------------1-------------------------------------1---111111------------------11--12-411313122211-1-2--1-111--------22-------------------------11---1112-B6-2------------------24-2------LH-----1-------1---------------3-1------1------------------1--3-1-1-----------12-----1------------------------------------------------------42--1543----11-1-------4---------1112-----3-----3---------------------------1-------------21152-1--21-2-----22------------------1-------1------1-2-21--5421143441552---------------32-11-----------------------------211121------------------------------------------------------------------------------------5-11-1-11--3443-----------------------1----------------------------------------------------------------------------- ---------------1----11-----------2------------------27--------------------------1------1--1------------1-------------------------------------------------------------------11----11-------------1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 514 STR:RPRED 91.8 SQ:SECSTR ##############################################HHHTTccccccTccccccEEEcEEEEEcccHHHHHHHHHHHHTTccEEEEcccccccTTGGGccccEEccccHHHHHTTccccHHHHHHHHHHHTTTcccHHHHHHHHHHHHHHHHHHHHTTccccEEEccTTcccTcccccEEETccccTTTccHHHHHHHHHHHHHHHHHHHTTcEEEccEEEEEEEETTccEEEEEEEETTTEEEEEEEEEEEEcccccTTcHHHHHHHcGGGTTccccccccTTcccHHHHHHHHTTccEEcTTcEEEEEEEETTTcccccccccTHHTHHHHTTcEEEcTTccccccTTccHHHHHHHHHTcGGcEEEEEEHHHHHHcTHHHHHHHHTccccEEEEccccHHHHHHcTTHHHHHHTTccEEEccHHHHHHHHTccHHHHHHHHHHHHHHHHTTccTTTccccccccccccccEEEEEEEEEEEEEccEEEccTTcEEEcTTccEEEEEEEccTTEEcccTTccccccTTHHHHHHHHHHHHHHHHHHHH PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccEEEEEEEEcccHHHHHHHHHHHHcccEEEEEEcccccccHHHHHcccccHHHHHccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHcccEEEEccEEEEEEEEccEEEEEEEEccccEEEEEEcccEEEEcccccccHHHHHHHcccccccccccccccccHHHHHHHHHHHcccEEcccEEEEcccccccccccccccccccHHHcccccEEEEcccccccccccccHHHHHHHHHHccccccEEHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHcHHccEEEEcccHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEEEEEEEEEcccEEEccccEEEccccccccccHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHcc //