[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54167.1
DDBJ      :             LamB/YcsF family protein
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  405/915 : Eukaryota  31/199 : Viruses  0/175   --->[See Alignment]
c.6.2
:254 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->248 1v6tA PDBj 2e-71 51.9 %
:RPS:PDB   4->239 2dfaA PDBj 2e-16 45.3 %
:RPS:SCOP  3->253 1v6tA  c.6.2.5 * 1e-41 50.4 %
:HMM:SCOP  2->255 1v6tA_ c.6.2.5 * 3.5e-97 54.7 %
:RPS:PFM   4->242 PF03746 * LamB_YcsF 6e-75 56.1 %
:HMM:PFM   3->243 PF03746 * LamB_YcsF 3.3e-108 56.0 241/242  
:BLT:SWISS 3->248 Y993_PYRAB 2e-74 52.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54167.1 GT:GENE ACV54167.1 GT:PRODUCT LamB/YcsF family protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(241684..242448) GB:FROM 241684 GB:TO 242448 GB:DIRECTION - GB:PRODUCT LamB/YcsF family protein GB:NOTE PFAM: LamB/YcsF family protein; KEGG: vei:Veis_0374 LamB/YcsF family protein GB:PROTEIN_ID ACV54167.1 GB:DB_XREF GI:257473847 InterPro:IPR005501 LENGTH 254 SQ:AASEQ MYRIDLNSDLGESFGRYTLGLDDQIIPLVSSANIACGQHAGDPVVMRKTVGMAKDAGIAIGAHPGYPDLQGFGRRDMHLSPDEAYSYMLYQIGALQAFCSAQGVQLAHVKPHGQLYNHAAIDSELAAALAQAVRDVDPKLVLVGLANSALVDEGRKLGLVTAEEFFADRNYTDEGRLVSRNDPAALIRDEEHAIERVKNAIREGAVLSVTGKLVDLHPDTLCVHGDSPSALAFVSRIRQELEQDDIAIKAVGAE GT:EXON 1|1-254:0| BL:SWS:NREP 1 BL:SWS:REP 3->248|Y993_PYRAB|2e-74|52.0|246/255| SEG 119->132|aaidselaaalaqa| BL:PDB:NREP 1 BL:PDB:REP 3->248|1v6tA|2e-71|51.9|241/249| RP:PDB:NREP 1 RP:PDB:REP 4->239|2dfaA|2e-16|45.3|236/247| RP:PFM:NREP 1 RP:PFM:REP 4->242|PF03746|6e-75|56.1|239/241|LamB_YcsF| HM:PFM:NREP 1 HM:PFM:REP 3->243|PF03746|3.3e-108|56.0|241/242|LamB_YcsF| RP:SCP:NREP 1 RP:SCP:REP 3->253|1v6tA|1e-41|50.4|246/249|c.6.2.5| HM:SCP:REP 2->255|1v6tA_|3.5e-97|54.7|254/0|c.6.2.5|1/1|Glycoside hydrolase/deacetylase| OP:NHOMO 527 OP:NHOMOORG 443 OP:PATTERN ------------------------------------------------------1111111------- --1-11-11111-1111----11112-----111111243111-1111-11-332111--11111111111--------11----------------------11-------------------------------111-----11-------------------------------------11111---1-111111111111111111111111111111--------2111111111111111111111-------1-------------1-------------------------------------------------1--1-----------111---------1--1-----1--11-111-11-------------1121211111111------------11211312----4223112321--1111-112111112111111111-111-1-1-----------------------------1-----221-11113212222222112222112211111--112--1--2--222--11---1---11111----1---1-1-----------------------1--1-----11111------------1------111111-111-----------1----12-------------1133-111111111111-1111111111111111111111211111111111111111111111111111-111111111111---1---------1--11-------1111-11-11111111-11-33331214222221332111-111-1-11111111111111-----------------------------------------------------------------------1- ---------------1-111111111111--------------111---1-111------------------2----------------111-----11-1---------------------------------------------------------1----1-------------------------1--------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 248 STR:RPRED 97.6 SQ:SECSTR ##EEEEEEEEccccTTcccccHHHHTTTccEEEEEcccccccHHHHHHHHHHHHHTTcEEEEEcccccTTTTTcccccccHHHHHHHHHHHHHHHHHHHHHTTcccccccccHHHHHHHHHcHHHHHHHHHHHHHHcTTccEEEcTTcHHHHHHHHTTccEEEEEcTTccccTTcccccTTcTTcccccHHHHHHHHHHHHHTcEEEcTTccEEEccccEEEEcccHHHHHHHHHHHHTHHHHTTcEEcc#### PSIPRED ccEEEccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHccHHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHccccEEEEEEccccccccccEEEccccccccccHHHHHHHHHHHHHcccEEEEccEEEEEEEEEEEEEcccHHHHHHHHHHHHHHHHcccEEEccccc //