[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54184.1
DDBJ      :             drug resistance transporter, EmrB/QacA subfamily
Swiss-Prot:             

Homologs  Archaea  25/68 : Bacteria  553/915 : Eukaryota  19/199 : Viruses  0/175   --->[See Alignment]
d.37.1f.38.1
:625 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   567->616 1xkfB PDBj 1e-05 28.0 %
:RPS:PDB   479->616 2d4zA PDBj 8e-17 15.2 %
:RPS:SCOP  3->183 1pw4A  f.38.1.1 * 7e-12 15.0 %
:RPS:SCOP  256->405 1pw4A  f.38.1.1 * 2e-04 14.6 %
:RPS:SCOP  483->618 2yziA1  d.37.1.1 * 3e-18 27.4 %
:HMM:SCOP  1->459 1pw4A_ f.38.1.1 * 2.5e-61 23.4 %
:HMM:SCOP  466->533 2nycA1 d.37.1.1 * 1e-10 26.5 %
:HMM:SCOP  554->620 2nycA1 d.37.1.1 * 8.9e-10 34.3 %
:RPS:PFM   18->178,253->340 PF07690 * MFS_1 2e-05 24.4 %
:RPS:PFM   483->613 PF00478 * IMPDH 2e-05 32.0 %
:HMM:PFM   15->401 PF07690 * MFS_1 4e-42 22.1 344/353  
:HMM:PFM   403->465 PF07690 * MFS_1 0.001 15.9 63/353  
:HMM:PFM   478->531 PF00571 * CBS 1.7e-14 29.6 54/57  
:HMM:PFM   564->617 PF00571 * CBS 1.2e-09 27.8 54/57  
:BLT:SWISS 2->408 LMRB_BACSU 7e-50 35.1 %
:BLT:SWISS 479->615 Y1225_METJA 2e-08 32.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54184.1 GT:GENE ACV54184.1 GT:PRODUCT drug resistance transporter, EmrB/QacA subfamily GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 267497..269374 GB:FROM 267497 GB:TO 269374 GB:DIRECTION + GB:PRODUCT drug resistance transporter, EmrB/QacA subfamily GB:NOTE KEGG: bcz:BCZK0949 permease, general substrate transporter; TIGRFAM: drug resistance transporter, EmrB/QacA subfamily; PFAM: major facilitator superfamily MFS_1; CBS domain containing protein; SMART: CBS domain containing protein GB:PROTEIN_ID ACV54184.1 GB:DB_XREF GI:257473864 InterPro:IPR000644 InterPro:IPR004638 InterPro:IPR007114 InterPro:IPR011701 LENGTH 625 SQ:AASEQ MQGKPLVLLLSVLYGSAFIAGFNENLVNMALVSIMAEYGVDSVTAQWLVTGYMIVATVVVTCMAFLYRRFHVRTLFFGAAGLSIVGSAMGLVAPSFELLLVARLVQAVGTGIFIPLMMNTILVVTPKNKLGTYLSVGGCMITFGPAFAPVVCGALVTAFGWHSIFVVPIVAMAVLAVLGFFYMKNLETHEAHLDVLSVVLSAVALTVLSFGLTQLTTDGVLAVAALVLAAAMVAVFVVRQLRCAHPLIDLAPMKNRAFWPAIILVTIAMMSMFSMSVLLPLYFEGAAGMTAFAAGLVILVPVLANAGATLLGGRIMDKRGEWPLLPLGFGGIAVGFIALVAVAPQLSVPAVFAAMLVMYVAVGFIFSPSQTAGLRALPPRQNPFGVALMTTFVQIAACIGPSLYIGIMSSGQAGAAASGASAAQATADGFALAMAVAAAIGVVGFALALAYARAARKRAAVQAVERAAQPQALSVLASIMEADPYTLPAATPVREAMRAFVDLRVGGLPLVDEQGHPAGFVSDGDVMRYLADKHPLITGSYSLVEAANSQTFDERLRELIELPVSAIATDKLVAIEAGSSLEEVCNLLATRRLKKVPVVRDGAIVGTVNRSDVLRYAMDTCLQGV GT:EXON 1|1-625:0| BL:SWS:NREP 2 BL:SWS:REP 2->408|LMRB_BACSU|7e-50|35.1|405/479| BL:SWS:REP 479->615|Y1225_METJA|2e-08|32.7|113/280| TM:NTM 14 TM:REGION 1->23| TM:REGION 46->67| TM:REGION 77->99| TM:REGION 105->127| TM:REGION 133->155| TM:REGION 163->184| TM:REGION 193->215| TM:REGION 225->247| TM:REGION 260->282| TM:REGION 292->314| TM:REGION 322->344| TM:REGION 349->371| TM:REGION 385->407| TM:REGION 430->452| SEG 191->209|ahldvlsvvlsavaltvls| SEG 220->238|vlavaalvlaaamvavfvv| SEG 409->472|ssgqagaaasgasaaqatadgfalamavaaaigvvgfalalayaraarkraavqaveraaqpqa| BL:PDB:NREP 1 BL:PDB:REP 567->616|1xkfB|1e-05|28.0|50/123| RP:PDB:NREP 1 RP:PDB:REP 479->616|2d4zA|8e-17|15.2|138/169| RP:PFM:NREP 2 RP:PFM:REP 18->178,253->340|PF07690|2e-05|24.4|248/347|MFS_1| RP:PFM:REP 483->613|PF00478|2e-05|32.0|100/459|IMPDH| HM:PFM:NREP 4 HM:PFM:REP 15->401|PF07690|4e-42|22.1|344/353|MFS_1| HM:PFM:REP 403->465|PF07690|0.001|15.9|63/353|MFS_1| HM:PFM:REP 478->531|PF00571|1.7e-14|29.6|54/57|CBS| HM:PFM:REP 564->617|PF00571|1.2e-09|27.8|54/57|CBS| GO:PFM:NREP 3 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| GO:PFM GO:0003824|"GO:catalytic activity"|PF00478|IPR001093| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00478|IPR001093| RP:SCP:NREP 3 RP:SCP:REP 3->183|1pw4A|7e-12|15.0|180/434|f.38.1.1| RP:SCP:REP 256->405|1pw4A|2e-04|14.6|148/434|f.38.1.1| RP:SCP:REP 483->618|2yziA1|3e-18|27.4|113/132|d.37.1.1| HM:SCP:REP 1->459|1pw4A_|2.5e-61|23.4|394/447|f.38.1.1|1/1|MFS general substrate transporter| HM:SCP:REP 466->533|2nycA1|1e-10|26.5|68/0|d.37.1.1|1/2|CBS-domain| HM:SCP:REP 554->620|2nycA1|8.9e-10|34.3|67/0|d.37.1.1|2/2|CBS-domain| OP:NHOMO 1408 OP:NHOMOORG 597 OP:PATTERN ------2-1111112-----------------2131--1--1-534122-211-----1--1------ 1-1-41123332-132133-32--6333333322223441-3331452122-2322-2--251-122352-43333641262-12111221--1-----------3------------------1--1----11--12213111432111111--11-------11-1131-------------------13-844444334244433252665634411224414344442D24333333333333353345147189152-2A8667743475843322211-1111-----------11111111111111-----1--1-1-67---11--1-1-266-111--------31343232-13321-----1--411211112124243113222211321233332-1111132214--32227737653512-1--2-1111-----------2--11111------------11---11--1--1------232221-136777763333255BA3333249584645--447-122221223124-----211211111---112-1-11-11--1221-1-1-1-21211-1---1----------------------11-11222-21--11-11111-11222-11-1-11-------------22541211111111111-11111111-111111111--2-2422132-3223222223232311-2221--222222222222----11-11------33-----2--11------24444-2113--2122352422131-333----------1111-------1--2122222222--------------------------------------------------------------- -------------1--11--1------------2-1----------1--112-1---1--1----------------------------1--1------12---1-----------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 142 STR:RPRED 22.7 SQ:SECSTR ##########################################################################################################################################################################################################################################################################################################################################################################################################################################################################################ccGGccccccccEETTccHHHHHHHHHHccccEEEEEcTTccEEEEEEHHHHHHHHHHHHHTTcccccccccccccHHHHHHTTccccTTcccEEcccccccTTccHHHHHHHHHHHTccEEEEEETTEEEEEEEHHHHHHH######### DISOP:02AL 624-626| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHcccccccHHHHHHHHcccccEEEcccccHHHHHHHHHHccccEEEEEccccEEEEEEEHHHHHHHHHccccccHHHHHHHccccHHHHHHHHHHHHcccHHHHcccccEEEcccccHHHHHHHHHHcccccccEEEccEEEEEEEHHHHHHHHHHcccccc //