[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54188.1
DDBJ      :             transcriptional regulator, MerR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.6.1
:252 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   10->62 1q06B PDBj 2e-07 39.6 %
:RPS:PDB   3->112 3d6yA PDBj 1e-10 14.7 %
:RPS:PDB   127->169 3d71A PDBj 1e-06 20.0 %
:RPS:SCOP  7->61 1j9iA  a.6.1.5 * 8e-09 10.9 %
:RPS:SCOP  131->169 1j9iA  a.6.1.5 * 4e-05 20.0 %
:HMM:SCOP  6->119 1jbgA_ a.6.1.3 * 4.2e-15 22.6 %
:HMM:SCOP  130->251 1jbgA_ a.6.1.3 * 1.8e-18 34.3 %
:HMM:PFM   8->45 PF00376 * MerR 8.5e-13 44.7 38/38  
:HMM:PFM   134->168 PF00376 * MerR 8.7e-12 34.3 35/38  
:HMM:PFM   173->209 PF09278 * MerR-DNA-bind 9.6e-05 41.7 36/65  
:BLT:SWISS 8->84 Y701_SYNY3 4e-07 34.7 %
:PROS 10->32|PS00552|HTH_MERR_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54188.1 GT:GENE ACV54188.1 GT:PRODUCT transcriptional regulator, MerR family GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 275586..276344 GB:FROM 275586 GB:TO 276344 GB:DIRECTION + GB:PRODUCT transcriptional regulator, MerR family GB:NOTE PFAM: regulatory protein MerR; SMART: regulatory protein MerR; KEGG: bpl:BURPS1106A_2249 MerR family transcriptional regulator GB:PROTEIN_ID ACV54188.1 GB:DB_XREF GI:257473868 InterPro:IPR000551 LENGTH 252 SQ:AASEQ MDQPRTYTTSRIASAVGIHPNTVRLYERIGFITAPERLANGYRVFTDLHLLQVRLVRAALNVELVQNGLRREVLAIVETMASQRYDEAISLARQRIDHLRRERCAAEDALRHVRDLLSRSDGSARAERLMLTRKEAADQLDTTIDALRNWEMNGLLQVKRKQNGYRVYSAADLDRLAIIRALRAANYSLAAILRLLDALDRDATADIGHVLDHPDPDDDILSVCDRLLTSLDAAERNAFEMIELLERMKKLA GT:EXON 1|1-252:0| BL:SWS:NREP 1 BL:SWS:REP 8->84|Y701_SYNY3|4e-07|34.7|72/137| PROS 10->32|PS00552|HTH_MERR_1|PDOC00477| SEG 170->185|aadldrlaiiralraa| SEG 189->207|laailrlldaldrdatadi| BL:PDB:NREP 1 BL:PDB:REP 10->62|1q06B|2e-07|39.6|53/126| RP:PDB:NREP 2 RP:PDB:REP 3->112|3d6yA|1e-10|14.7|109/277| RP:PDB:REP 127->169|3d71A|1e-06|20.0|43/277| HM:PFM:NREP 3 HM:PFM:REP 8->45|PF00376|8.5e-13|44.7|38/38|MerR| HM:PFM:REP 134->168|PF00376|8.7e-12|34.3|35/38|MerR| HM:PFM:REP 173->209|PF09278|9.6e-05|41.7|36/65|MerR-DNA-bind| RP:SCP:NREP 2 RP:SCP:REP 7->61|1j9iA|8e-09|10.9|55/68|a.6.1.5| RP:SCP:REP 131->169|1j9iA|4e-05|20.0|39/68|a.6.1.5| HM:SCP:REP 6->119|1jbgA_|4.2e-15|22.6|106/106|a.6.1.3|1/2|Putative DNA-binding domain| HM:SCP:REP 130->251|1jbgA_|1.8e-18|34.3|105/106|a.6.1.3|2/2|Putative DNA-binding domain| OP:NHOMO 17 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------1-------------1---------------------------------------------------------------1----------------------------------------------------------------1---------------------1----------------------------------------------------------------------------------------------1-1111211-1--1-----------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 162 STR:RPRED 64.3 SQ:SECSTR ##ccccEEHHHHHHHHTccHHHHHHHHHTTccccEEcTTTccEEEcGGGGGHHHHHHHHHHTTccHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH#####ccccEEHHHHHHHHTccHHHHHHHHHTTcccEEcTTTccEEEc################################################################################### PSIPRED ccccccccHHHHHHHHcccHHHHHHHHHHcccccccccccccEEccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccEEccHHHHHHHHHHHHHHHccccHHHHHHHHHHccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //