[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54193.1
DDBJ      :             addiction module toxin, RelE/StbE family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  38/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.298.1
:93 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->93 2otrA PDBj 2e-08 34.1 %
:RPS:PDB   7->93 3bpqB PDBj 1e-07 14.1 %
:RPS:SCOP  1->93 1z8mA1  d.298.1.2 * 4e-18 29.5 %
:HMM:SCOP  1->93 1z8mA1 d.298.1.2 * 4.8e-19 35.2 %
:HMM:PFM   7->91 PF05016 * Plasmid_stabil 1.2e-05 25.0 76/88  
:BLT:SWISS 7->93 YAFQ_ECOLI 4e-13 37.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54193.1 GT:GENE ACV54193.1 GT:PRODUCT addiction module toxin, RelE/StbE family GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(279551..279832) GB:FROM 279551 GB:TO 279832 GB:DIRECTION - GB:PRODUCT addiction module toxin, RelE/StbE family GB:NOTE TIGRFAM: addiction module toxin, RelE/StbE family; KEGG: yen:YE1929 hypothetical protein GB:PROTEIN_ID ACV54193.1 GB:DB_XREF GI:257473873 InterPro:IPR012753 LENGTH 93 SQ:AASEQ MYRSINSPAFERDVKKCMKKHWDMGSFKAAISAILHSDEEPIPLKYNDHALSGNLQGKRELHVKGRTSDWLIMYEIVDGVVGFARTGGHDDLF GT:EXON 1|1-93:0| BL:SWS:NREP 1 BL:SWS:REP 7->93|YAFQ_ECOLI|4e-13|37.3|83/92| BL:PDB:NREP 1 BL:PDB:REP 7->93|2otrA|2e-08|34.1|82/90| RP:PDB:NREP 1 RP:PDB:REP 7->93|3bpqB|1e-07|14.1|78/85| HM:PFM:NREP 1 HM:PFM:REP 7->91|PF05016|1.2e-05|25.0|76/88|Plasmid_stabil| RP:SCP:NREP 1 RP:SCP:REP 1->93|1z8mA1|4e-18|29.5|88/88|d.298.1.2| HM:SCP:REP 1->93|1z8mA1|4.8e-19|35.2|88/0|d.298.1.2|1/1|RelE-like| OP:NHOMO 40 OP:NHOMOORG 38 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------1----11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1--------------------------------------------------------------------------------------------121-------------2------------------------1-------------------------------------------------------------------------------------1----------------------------------------------------------------1----------------------------------------------------1------------------------------------------------------------------------------11--1---11--111---1-11--11111--------1--1-1-1-1---1------1---1--1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 85 STR:RPRED 91.4 SQ:SECSTR ######cHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHccccccccEEEcTTcccEEEEEEcc##TTEEEEEEEETTEEEEEEEEEHHHHG DISOP:02AL 92-94| PSIPRED ccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHccccccccccccEEEEEccccccEEEEEEEEccEEEEEEcccHHHHc //