[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54207.1
DDBJ      :             transcriptional regulator, Crp/Fnr family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  66/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5b.82.3
:224 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   38->224 3dkwA PDBj 4e-06 26.3 %
:RPS:PDB   7->224 3e6cC PDBj 4e-23 15.9 %
:RPS:SCOP  4->149 2h6bA2  b.82.3.2 * 5e-15 17.6 %
:RPS:SCOP  157->224 2gauA1  a.4.5.4 * 9e-06 17.6 %
:HMM:SCOP  1->150 1zybA2 b.82.3.2 * 4e-26 30.1 %
:HMM:SCOP  152->225 1zybA1 a.4.5.4 * 1.5e-10 24.7 %
:RPS:PFM   35->110 PF00027 * cNMP_binding 2e-08 42.5 %
:RPS:PFM   179->209 PF00325 * Crp 2e-04 45.2 %
:HMM:PFM   34->115 PF00027 * cNMP_binding 1.8e-15 32.1 81/91  
:HMM:PFM   182->213 PF01325 * Fe_dep_repress 0.0004 28.1 32/60  
:BLT:SWISS 38->219 BTR_BORPE 2e-07 26.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54207.1 GT:GENE ACV54207.1 GT:PRODUCT transcriptional regulator, Crp/Fnr family GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(295954..296628) GB:FROM 295954 GB:TO 296628 GB:DIRECTION - GB:PRODUCT transcriptional regulator, Crp/Fnr family GB:NOTE PFAM: cyclic nucleotide-binding; SMART: cyclic nucleotide-binding; KEGG: dds:Ddes_1827 transcriptional regulator, Crp/Fnr family GB:PROTEIN_ID ACV54207.1 GB:DB_XREF GI:257473887 InterPro:IPR000595 InterPro:IPR012318 LENGTH 224 SQ:AASEQ MEHHLPLIGRSPLFANIDAADLAPMLQCLGARKRTFPKGSYLFRVGDRTTAMGIMLEGSVRLEKEDYWGNRSILASFGPGQSFAEVYACEPDLAFDINVVAAEDATVLFLDIGRVTTMCPSSCAFHARLIRNLLGIVAKRTHALTRKIEHTTKRTTRAKLLSYLSDQAEAAHASRFVIPFDRQELADYLSVDRSAMCAELSRMKRDGLIDYNRNQFEIVRRSAL GT:EXON 1|1-224:0| BL:SWS:NREP 1 BL:SWS:REP 38->219|BTR_BORPE|2e-07|26.1|176/242| BL:PDB:NREP 1 BL:PDB:REP 38->224|3dkwA|4e-06|26.3|179/227| RP:PDB:NREP 1 RP:PDB:REP 7->224|3e6cC|4e-23|15.9|208/225| RP:PFM:NREP 2 RP:PFM:REP 35->110|PF00027|2e-08|42.5|73/90|cNMP_binding| RP:PFM:REP 179->209|PF00325|2e-04|45.2|31/31|Crp| HM:PFM:NREP 2 HM:PFM:REP 34->115|PF00027|1.8e-15|32.1|81/91|cNMP_binding| HM:PFM:REP 182->213|PF01325|0.0004|28.1|32/60|Fe_dep_repress| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00325|IPR001808| GO:PFM GO:0005622|"GO:intracellular"|PF00325|IPR001808| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00325|IPR001808| RP:SCP:NREP 2 RP:SCP:REP 4->149|2h6bA2|5e-15|17.6|136/145|b.82.3.2| RP:SCP:REP 157->224|2gauA1|9e-06|17.6|68/81|a.4.5.4| HM:SCP:REP 1->150|1zybA2|4e-26|30.1|146/0|b.82.3.2|1/1|cAMP-binding domain-like| HM:SCP:REP 152->225|1zybA1|1.5e-10|24.7|73/0|a.4.5.4|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 83 OP:NHOMOORG 66 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------1------------------------------13111-----111---------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------1--111111111-1-2133122112112-111-351-11-------1---------------------------1----------------------1------------------------------------------------------------------------------------------------------------------11---------------1-1--------------11-111---11---11--------1-------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1----------------------------11---1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 224 STR:RPRED 100.0 SQ:SECSTR HcccHHcccccccccccccGGGGGGGGGcTcEEEEEcTTcEEEcTTcccccEEEEEEccEEEEEEcTTccEEEEEEEcTTcEEccccTTTTcccccEEEEEcccEEEEEEcHHHHHHHHHHcTHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHETTEEEEEccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEcccEEEEccHHHH PSIPRED ccHHHHHHHHcHHHccccHHHHHHHHHHcccEEEEEccccEEEcccccccEEEEEEEEEEEEEEEcccccEEEEEEEccccEEEEHHHHcccccccEEEEEEccEEEEEEEHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEccEEEEEcHHHc //