[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54212.1
DDBJ      :             RelA/SpoT domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  190/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.218.1
:247 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   53->247 2be3A PDBj 3e-16 34.5 %
:RPS:PDB   53->239 2be3A PDBj 2e-29 29.4 %
:RPS:SCOP  49->238 2be3A1  d.218.1.8 * 1e-37 30.5 %
:HMM:SCOP  47->247 2be3A1 d.218.1.8 * 6.4e-52 37.9 %
:RPS:PFM   91->208 PF04607 * RelA_SpoT 7e-21 43.5 %
:HMM:PFM   90->209 PF04607 * RelA_SpoT 2e-38 49.1 110/112  
:BLT:SWISS 38->236 YWAC_BACSU 1e-40 42.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54212.1 GT:GENE ACV54212.1 GT:PRODUCT RelA/SpoT domain protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 305950..306693 GB:FROM 305950 GB:TO 306693 GB:DIRECTION + GB:PRODUCT RelA/SpoT domain protein GB:NOTE PFAM: RelA/SpoT domain protein; KEGG: bha:BH1885 hypothetical protein GB:PROTEIN_ID ACV54212.1 GB:DB_XREF GI:257473892 InterPro:IPR007685 LENGTH 247 SQ:AASEQ MADASQQPSDRRLAVEAQRGEGASRFPFLLTDDLRSPLDDLQRLRDAEVKTREIIQKYQAAMREMMVRFEILDQDLNLKKHRNPIHHLESRIKKPASIFEKLERYGKEPTLENLERFIMDVAGVRVICSYIHDVYNLLELLQKQDDLEIVEIKDYINNPKPNGYRSLHVIVRIPVYFLDKKELIPVEVQLRTIAMDFWASLEHDLKYKSVSEVQGIDSYDELKDCSRIIEDVESRMQILARALEMED GT:EXON 1|1-247:0| BL:SWS:NREP 1 BL:SWS:REP 38->236|YWAC_BACSU|1e-40|42.6|195/210| SEG 137->148|llellqkqddle| BL:PDB:NREP 1 BL:PDB:REP 53->247|2be3A|3e-16|34.5|174/197| RP:PDB:NREP 1 RP:PDB:REP 53->239|2be3A|2e-29|29.4|180/197| RP:PFM:NREP 1 RP:PFM:REP 91->208|PF04607|7e-21|43.5|108/112|RelA_SpoT| HM:PFM:NREP 1 HM:PFM:REP 90->209|PF04607|2e-38|49.1|110/112|RelA_SpoT| GO:PFM:NREP 1 GO:PFM GO:0015969|"GO:guanosine tetraphosphate metabolic process"|PF04607|IPR007685| RP:SCP:NREP 1 RP:SCP:REP 49->238|2be3A1|1e-37|30.5|187/203|d.218.1.8| HM:SCP:REP 47->247|2be3A1|6.4e-52|37.9|198/0|d.218.1.8|1/1|Nucleotidyltransferase| OP:NHOMO 290 OP:NHOMOORG 190 OP:PATTERN -------------------------------------------------------------------- --------111-------------------------1111-----1111--1----1-----2-1------1111111--11-----------------------------------------------------------------------------------------------------111------12222222222222222222222222111211222222222222222222222222222221212112221222121111211-22222211112221111111111122222222222222111111111-222211111112121111111121----321-21----------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 195 STR:RPRED 78.9 SQ:SECSTR ####################################################HHHHHHHHHHHHHHHHHHHHHHHHHHTTccccEEEEEEEEccHHHHHHHHHHTccTTTHHHHTTTcTTcEEEEEEEccGGGHcHHHHHHHHTcccEEEEEEETTTTccTTccccEEEEEEEEEccTTccEEEEEEEEEEEHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHHTTHHHHHHHHH DISOP:02AL 246-248| PSIPRED ccccHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEccHHHHHHHHHHccccccHHHHHHHHHHHHEEEEEEccHHHHHHHHHHHHHccccEEEEEEcccccccccccEEEEEEEEEccccccccccEEEEEEEcHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //