[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54229.1
DDBJ      :             extracellular solute-binding protein family 3
Swiss-Prot:             

Homologs  Archaea  30/68 : Bacteria  641/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:267 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   50->265 1wdnA PDBj 9e-29 32.2 %
:RPS:PDB   50->266 3delB PDBj 3e-39 18.2 %
:RPS:SCOP  49->266 1ii5A  c.94.1.1 * 1e-43 25.1 %
:HMM:SCOP  3->266 2a5sA1 c.94.1.1 * 7.3e-63 37.0 %
:RPS:PFM   58->267 PF00497 * SBP_bac_3 6e-25 32.9 %
:HMM:PFM   51->266 PF00497 * SBP_bac_3 4.3e-65 38.3 214/225  
:HMM:PFM   7->48 PF05481 * Myco_19_kDa 0.00018 30.0 40/160  
:BLT:SWISS 48->265 GLNH_ECOLI 1e-29 32.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54229.1 GT:GENE ACV54229.1 GT:PRODUCT extracellular solute-binding protein family 3 GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 325394..326197 GB:FROM 325394 GB:TO 326197 GB:DIRECTION + GB:PRODUCT extracellular solute-binding protein family 3 GB:NOTE PFAM: extracellular solute-binding protein family 3; SMART: extracellular solute-binding protein family 3; ionotropic glutamate receptor; KEGG: smd:Smed_2979 extracellular solute-binding protein family 3 GB:PROTEIN_ID ACV54229.1 GB:DB_XREF GI:257473909 InterPro:IPR001320 InterPro:IPR001638 LENGTH 267 SQ:AASEQ MNIKKWGALVAAGALAASLALFGCSSGDQGTTTSSTSGNDAGYTLVNDGKLTVAASLDFPPFENLNGDKPEGFAVDLMTLLAEEMGLECEYLPSTKFDTIVPLIQTGGKADVGVSSFTITDKRLQQVDFTDPYCNVNQSITVRSDSGITDVAQLEGKKIGAQSGTTGYEWAAENIKDAEVTGYDEMTAVFAALDSGQIDAVSVDLPVANYYVRSYSDCQVIKEIPTGEQYAVTVSKENPELTKALNKALQAVHDNGKYDELAAKWLQ GT:EXON 1|1-267:0| BL:SWS:NREP 1 BL:SWS:REP 48->265|GLNH_ECOLI|1e-29|32.9|216/248| TM:NTM 1 TM:REGION 6->24| SEG 7->38|galvaagalaaslalfgcssgdqgtttsstsg| BL:PDB:NREP 1 BL:PDB:REP 50->265|1wdnA|9e-29|32.2|214/223| RP:PDB:NREP 1 RP:PDB:REP 50->266|3delB|3e-39|18.2|214/232| RP:PFM:NREP 1 RP:PFM:REP 58->267|PF00497|6e-25|32.9|207/222|SBP_bac_3| HM:PFM:NREP 2 HM:PFM:REP 51->266|PF00497|4.3e-65|38.3|214/225|SBP_bac_3| HM:PFM:REP 7->48|PF05481|0.00018|30.0|40/160|Myco_19_kDa| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00497|IPR001638| GO:PFM GO:0006810|"GO:transport"|PF00497|IPR001638| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF00497|IPR001638| RP:SCP:NREP 1 RP:SCP:REP 49->266|1ii5A|1e-43|25.1|211/222|c.94.1.1| HM:SCP:REP 3->266|2a5sA1|7.3e-63|37.0|243/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 2782 OP:NHOMOORG 676 OP:PATTERN 11---1----------1-2222212--11-1111----7589311114----1----1------1--- ----321222223-12211-171128111111A66636A8-4123131222-654222--112-74463516444555214-1--------------------------1----------------------2----11221111---12--11111-------11-1141------------4341111--23344444654445444331-44444321345433333382111111111111111122124535875544566556636457322244433332555656666555633322333333332668776665146584535555232243323332322-3113166-4121-211112225---111-1211212331111111113443325545I---4--3-448--ICCBAABEDF9C75---125212222211111111211-12-2----------11---------------1-------46447EHHHIF55666DDCG666657HCF4974--7783254355B8AA122----752211111----2-18C1665937966735157-421122-2---4-6336444443-2--------22----664-4-----4-1111--31111111-121--4-1-1------76BD4996665664666-6666666566666566557GIEDB3227667777777777777D665656621767777776777--3-111116666--25722232311-1-111144444-33541-99798DAF857563977----------23343333334633-----------------7--------------1-3-------------------------121-113111--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------1--1-----------1--1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 228 STR:RPRED 85.4 SQ:SECSTR #######################################ccHHHHHTccEEEEEEccccTTTcEEcTTcEEcHHHHHHHHHHHHHTcEEEEEEcccGGGHHHHHHTTHcccEEcccccccHHHHTTEEEEEEEEEEEcEEEEEEEcccccccGGGcccEEEETTcHHHHHHHHHcTTccEEEEccHHHHHHHHHTTcccEEEEcHHHHHHHGGGcTTEEEccGGGcEEEEEEEEETTcHHHHHHHHHHHHHHHHTTHHHHHHHHTTc PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHcccEEEEEEcccccEEEEEccEEEEEHHHHHHHHHHHHccEEEEEEcccHHHHHHHHHcccEEEEEEccccccHHHHHHHHHcccEEEccEEEEEEcccccccHHHHcccEEEEEccccHHHHHHHHccccEEEEEccHHHHHHHHHccccEEEEEcHHHHHHHHHHcccEEEEccccccccEEEEEEcccHHHHHHHHHHHHHHHHccHHHHHHHHHcc //