[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54234.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:339 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   79->147 PF06157 * DUF973 0.00036 29.4 68/285  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54234.1 GT:GENE ACV54234.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 331554..332573 GB:FROM 331554 GB:TO 332573 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE KEGG: RNA-binding protein GB:PROTEIN_ID ACV54234.1 GB:DB_XREF GI:257473914 LENGTH 339 SQ:AASEQ MDEQTAPQPPVPPQPPVPPTVSAPPGSPAQPTQPMPQSAQAPGSAPYGQQPGQPFGQQPAGYYQPVPPQSNGKAVGALVCGILAILFSASILFGIALGIVAIVLAGQAVKQAGRDGKATGGKVCGIVGIVLSVLAFVLYVVIGVGVLAFVVGASDEYDRTYSLESSDLSSITQGDQQMEAAASEKLDLLKSKDAVLMRKIADQADEQLADATGYSLTDLGIDPLTFVEWMLVDFDYKLDGAYDNGDGTGTVYADVTLRDSMAFATTFMEDAQAAIDAGDLQSLDEAGAKVLLGELYQAAMDKTTAMTTDYVSLEVVKNGDSWQVDEDSWGDELDYLFGL GT:EXON 1|1-339:0| TM:NTM 2 TM:REGION 80->102| TM:REGION 127->149| SEG 4->29|qtapqppvppqppvpptvsappgspa| SEG 46->65|pygqqpgqpfgqqpagyyqp| SEG 140->152|vvigvgvlafvvg| SEG 298->309|aamdkttamttd| HM:PFM:NREP 1 HM:PFM:REP 79->147|PF06157|0.00036|29.4|68/285|DUF973| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 143-143,151-151,185-185,188-188,193-194,199-200,202-202,207-207,221-221,235-235,241-241,249-249,255-255,263-263,269-269,272-272,277-277,325-325,339-340| PSIPRED ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEHHHHHHccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHccccHHHccccHHHHHHHHHHccccccccccccccccEEEEEEEEEEcHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEccccEEEccccccHHHHHHHcc //