[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54238.1
DDBJ      :             channel protein, hemolysin III family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  554/915 : Eukaryota  36/199 : Viruses  0/175   --->[See Alignment]
:230 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   69->222 PF03006 * HlyIII 2e-08 36.0 %
:HMM:PFM   25->221 PF03006 * HlyIII 8.6e-46 34.5 197/221  
:BLT:SWISS 12->227 Y1037_TREPA 8e-34 43.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54238.1 GT:GENE ACV54238.1 GT:PRODUCT channel protein, hemolysin III family GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 335960..336652 GB:FROM 335960 GB:TO 336652 GB:DIRECTION + GB:PRODUCT channel protein, hemolysin III family GB:NOTE TIGRFAM: channel protein, hemolysin III family; PFAM: Hly-III family protein; KEGG: ilo:IL2439 hemolysin III-like protein GB:PROTEIN_ID ACV54238.1 GB:DB_XREF GI:257473918 InterPro:IPR004254 InterPro:IPR005744 LENGTH 230 SQ:AASEQ MHALRNEVSHTSASATNKARDIREYTLGEEIANSVTHGLGALLAIAAIPILVVRALDDGGGIYLFAALVYTLTMLLEYTMSTLYHAIAVDRAKRVFKVLDHSCIYLFIAGSYTPFCLISLADSGGVWLCAFVWLVALAGVACEAFWVFRPRWVSAVLYLLMGWCVIWFLPALIEAIPGPGLWLLVGGGICYSIGCIFYVLKKVPYMHSLFHLWVLAGSVLQFLAIFLYVM GT:EXON 1|1-230:0| BL:SWS:NREP 1 BL:SWS:REP 12->227|Y1037_TREPA|8e-34|43.3|215/238| TM:NTM 7 TM:REGION 34->56| TM:REGION 64->86| TM:REGION 97->119| TM:REGION 125->147| TM:REGION 153->175| TM:REGION 179->200| TM:REGION 208->230| SEG 38->56|glgallaiaaipilvvral| SEG 177->188|pgpglwllvggg| RP:PFM:NREP 1 RP:PFM:REP 69->222|PF03006|2e-08|36.0|150/221|HlyIII| HM:PFM:NREP 1 HM:PFM:REP 25->221|PF03006|8.6e-46|34.5|197/221|HlyIII| GO:PFM:NREP 1 GO:PFM GO:0016021|"GO:integral to membrane"|PF03006|IPR004254| OP:NHOMO 655 OP:NHOMOORG 590 OP:PATTERN -------------------------------------------------------------------- -1--1111111-1-11111-12--1111111112221111-111111-1111111111--111111121-1-111111-111------1111-1---------11---1---------------1---------1-111--1111--------------------------------------11111--1-11222222221222222111111222---1222111111-11111111111111111--111111111111111111111111111111111111111111111111111111111111111111111111-11212221222121-111122211----11--1111-1---------111-11111-------1111-1-1-1-11111111111-11111-11-1--111111111111-----11-1111------------------1---------------------------------------11111111111-11111111-1111-1-1--11--11---2112-1-11---111111111-11--12-2-1111--1111-1-1------11211--1------------------------11111-11-111111111111111111111111---1-1-------11111111111111111-111111111111111111111111---1111111111111111111111111-111111111111---1----------1111---------------1111111---1-11111111-11111111---------11111111111111111222222221111---111----111111-11111-1----------------------111-1-----12- ----11-----------------------------------------------------------------------------------------------------1-2-2143-----1-2-11---141---1----2--------111-1-1111-11111----1--11------------------23----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 8-20,230-231| PSIPRED ccHHHHHHHHccccHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHc //