[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54243.1
DDBJ      :             TrkA-N domain protein
Swiss-Prot:             

Homologs  Archaea  38/68 : Bacteria  375/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.2.1d.286.1
:225 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->130 1lssA PDBj 1e-17 37.8 %
:RPS:PDB   3->224 2aefA PDBj 5e-12 14.4 %
:RPS:SCOP  2->145 1id1A  c.2.1.9 * 1e-18 24.3 %
:RPS:SCOP  139->224 1vctA2  d.286.1.1 * 3e-05 18.3 %
:HMM:SCOP  1->148 1id1A_ c.2.1.9 * 2.6e-25 34.5 %
:RPS:PFM   3->118 PF02254 * TrkA_N 2e-11 33.6 %
:HMM:PFM   3->120 PF02254 * TrkA_N 6.1e-27 33.3 114/116  
:HMM:PFM   167->223 PF02080 * TrkA_C 7.2e-09 29.1 55/71  
:BLT:SWISS 1->224 TRKA_METTH 5e-27 35.8 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54243.1 GT:GENE ACV54243.1 GT:PRODUCT TrkA-N domain protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 341173..341850 GB:FROM 341173 GB:TO 341850 GB:DIRECTION + GB:PRODUCT TrkA-N domain protein GB:NOTE PFAM: TrkA-N domain protein; TrkA-C domain protein; KEGG: sat:SYN_02618 potassium transporter peripheral membrane component GB:PROTEIN_ID ACV54243.1 GB:DB_XREF GI:257473923 InterPro:IPR003148 InterPro:IPR006036 InterPro:IPR006037 LENGTH 225 SQ:AASEQ MYIVIAGGGKIGEYLASVLLSSGNDVAVIEENLATADRLSVALQGRYLVIHGDGCDSKYQEDAGIRRADVFVATTGQDDDNLVSCEIAQRVFNVPRCIARVNSPKNLRIFKEVGIECVSSTTLIANLIEEETLLGSVSVASSLTHGNVTLTEIVVPRMRHHSNEAGILVSSVPMPENSLIAAVSPKDDDNVEVASEETVLYPGDKAIVVADNEVLDEVRALFKGL GT:EXON 1|1-225:0| BL:SWS:NREP 1 BL:SWS:REP 1->224|TRKA_METTH|5e-27|35.8|215/216| BL:PDB:NREP 1 BL:PDB:REP 1->130|1lssA|1e-17|37.8|127/132| RP:PDB:NREP 1 RP:PDB:REP 3->224|2aefA|5e-12|14.4|215/221| RP:PFM:NREP 1 RP:PFM:REP 3->118|PF02254|2e-11|33.6|113/116|TrkA_N| HM:PFM:NREP 2 HM:PFM:REP 3->120|PF02254|6.1e-27|33.3|114/116|TrkA_N| HM:PFM:REP 167->223|PF02080|7.2e-09|29.1|55/71|TrkA_C| GO:PFM:NREP 1 GO:PFM GO:0006813|"GO:potassium ion transport"|PF02254|IPR003148| RP:SCP:NREP 2 RP:SCP:REP 2->145|1id1A|1e-18|24.3|144/153|c.2.1.9| RP:SCP:REP 139->224|1vctA2|3e-05|18.3|82/94|d.286.1.1| HM:SCP:REP 1->148|1id1A_|2.6e-25|34.5|148/0|c.2.1.9|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 533 OP:NHOMOORG 414 OP:PATTERN ----1-----------1------18442742213111-111111-1121242311111111------- ---22---------32222-22--3222222322222222222222--1---222221--22222-21122--------2221-----1111-111-------11---2---------------------1----1---34333-2----11----------------------------------11-------------------------------------------------------------------------------------------111----12211111111111----------------111----211--11-1111-1-2--------211-111-111-1-113-3---2-1--11----11111-------------111111111-1---------1-1--11-------11111111-11111211-------------111-----------------------------1-----11111---------------------------------1-1111-------11----1111111111-11--111-111--1---1-----------1---1----------------------------111111111111111111111111111111---11-1------11111111111111111-11-1111111111111111111111111111111111111111111111111-111111111111--11---------11111--1111111111111----------1111111111111111111---------111111111111111--------------11----------------1---------------------------2212222-22--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 224 STR:RPRED 99.6 SQ:SECSTR cEEEEEcccHHHHHHHHHcTTcEEEEEEccGGGccGGGHHHHHHTTcEEEEccTTcHHHHHHTTcTTccEEEEccccHHHHHHHHHHHHHHccccEEEEEcccGGGHHHHHHHTccEEEcHHHHHHHHHHHTcccHccHHHHHHHHHHcccEEEEEEccTTcTTTTccHHHHcHHHHHccEEEEEETTEEEEcccTTccccTTcEEEEEEcHHHHHHHHHHHcc# PSIPRED cEEEEEcccHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHccccEEEEEcccccHHHHHHccHHHccEEEEEcccHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHccccEEEEHHHHHHHHHHHHHccccEEEEHHHHHHHHHHHHHHHHcccccccccEEHHHcccccccEEEEEEEccccEEEccccccEEccccEEEEEEcHHHHHHHHHHHHcc //