[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54256.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:73 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   25->71 PF09855 * DUF2082 4.4e-05 31.1 45/64  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54256.1 GT:GENE ACV54256.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 357618..357839 GB:FROM 357618 GB:TO 357839 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: pat:Patl_2652 hypothetical protein GB:PROTEIN_ID ACV54256.1 GB:DB_XREF GI:257473936 LENGTH 73 SQ:AASEQ MGFMDGFERGLSGNYRYEIAGKAVVCSHCGGEEFDERSGQLNTAGASLLNLDWANATARVLVCQSCGHLEWFL GT:EXON 1|1-73:0| HM:PFM:NREP 1 HM:PFM:REP 25->71|PF09855|4.4e-05|31.1|45/64|DUF2082| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 73-74| PSIPRED ccHHHHHHHcccccEEEEEccEEEEEEccccHHHHHHHHHHHHccHHHHHHHHcccccEEEEEccccEEEEEc //