[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54264.1
DDBJ      :             protein of unknown function DUF322
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  61/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:170 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   42->124 2a2zB PDBj 2e-04 3.8 %
:RPS:PFM   43->134 PF03780 * DUF322 1e-09 35.2 %
:HMM:PFM   43->147 PF03780 * DUF322 1.3e-27 33.3 105/108  
:BLT:SWISS 43->134 ASP23_STAAW 5e-14 40.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54264.1 GT:GENE ACV54264.1 GT:PRODUCT protein of unknown function DUF322 GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(367794..368306) GB:FROM 367794 GB:TO 368306 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF322 GB:NOTE PFAM: protein of unknown function DUF322; KEGG: bha:BH2786 hypothetical protein GB:PROTEIN_ID ACV54264.1 GB:DB_XREF GI:257473944 InterPro:IPR005531 LENGTH 170 SQ:AASEQ MTQSTMTKPATSSTYNPYSDMDADKKKSDAATADSVSAEPVYKLVIDENVVEKISSMAAQKIDGIIDMKGNVLSRIQEGLGGADKTKGVDADIVDDTNAKINLDVIMEYGKSAPEIFDDIKKVVGGDLKDMTGLNVVEMTVNVVDVMTPEEYAQKNGSNSDDGQQDDSAN GT:EXON 1|1-170:0| BL:SWS:NREP 1 BL:SWS:REP 43->134|ASP23_STAAW|5e-14|40.7|91/169| SEG 19->38|sdmdadkkksdaatadsvsa| SEG 135->148|nvvemtvnvvdvmt| SEG 156->168|ngsnsddgqqdds| RP:PDB:NREP 1 RP:PDB:REP 42->124|2a2zB|2e-04|3.8|80/221| RP:PFM:NREP 1 RP:PFM:REP 43->134|PF03780|1e-09|35.2|91/107|DUF322| HM:PFM:NREP 1 HM:PFM:REP 43->147|PF03780|1.3e-27|33.3|105/108|DUF322| OP:NHOMO 69 OP:NHOMOORG 61 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------1-1----------------------------------------------------------------------------------------------------------------------------------------------1----------11111111111111111112-1-11-1---1111222-2------1111222--------------1111111111111---------1--------------------------11-----11----------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 80 STR:RPRED 47.1 SQ:SECSTR #########################################EEEEEEccHHHHHHHHHHHccTTTTTccHHHHHHHHHHHHHHHTccccccccTTTTTccE###EEEEcccccTTccHHHHHHH############################################## PSIPRED ccccccccccccccccccccHHHHccccccccccccccccccEEEEcHHHHHHHHHHHHHHcccEEEEcccHHHHHHHHHccccccccEEEEEEcccEEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHccEEEEEEEEEEccccccHHHHHccccccccccHHccc //