[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54265.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:148 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   84->132 PF10031 * DUF2273 2e-09 38.8 %
:HMM:PFM   84->131 PF10031 * DUF2273 6.5e-16 41.7 48/51  
:HMM:PFM   9->98 PF05460 * ORC6 0.00036 17.2 87/356  
:BLT:SWISS 59->126 COXX_SULIY 7e-04 35.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54265.1 GT:GENE ACV54265.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(368403..368849) GB:FROM 368403 GB:TO 368849 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV54265.1 GB:DB_XREF GI:257473945 LENGTH 148 SQ:AASEQ MTQSTMRIHPAATPAPKSAPKQSQAAKQKPKTTNAYASSNQKHDEQKAPQRTADTPSDVLANAAAETKRDKGVYASMKRAFSPYVENHSHAVLYGIIGFVAAALILIVGFWPTVLLAVFAAIGVVIGKYRDGDRKTRQQMKQVLERFN GT:EXON 1|1-148:0| BL:SWS:NREP 1 BL:SWS:REP 59->126|COXX_SULIY|7e-04|35.4|65/285| TM:NTM 1 TM:REGION 98->120| SEG 10->31|paatpapksapkqsqaakqkpk| RP:PFM:NREP 1 RP:PFM:REP 84->132|PF10031|2e-09|38.8|49/51|DUF2273| HM:PFM:NREP 2 HM:PFM:REP 84->131|PF10031|6.5e-16|41.7|48/51|DUF2273| HM:PFM:REP 9->98|PF05460|0.00036|17.2|87/356|ORC6| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 25-25,31-31,34-34,39-40,45-46,48-48,53-54,59-60,62-62,67-68,73-74,76-76,81-81,129-129,132-132| PSIPRED cccccEEEccccccccccccHHHHHHHHcccccHHHHcccHHHHHHHccHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHc //