[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54269.1
DDBJ      :             protein involved in biosynthesis of molybdopterin
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.41.5
:131 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  21->131 1fm0E  d.41.5.1 * 8e-07 21.2 %
:HMM:SCOP  1->123 1fm0E_ d.41.5.1 * 0.00012 25.2 %
:HMM:PFM   14->122 PF02391 * MoaE 3.2e-08 22.1 104/117  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54269.1 GT:GENE ACV54269.1 GT:PRODUCT protein involved in biosynthesis of molybdopterin GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(371379..371774) GB:FROM 371379 GB:TO 371774 GB:DIRECTION - GB:PRODUCT protein involved in biosynthesis of molybdopterin GB:NOTE KEGG: sat:SYN_01004 protein involved in biosynthesis of molybdopterin GB:PROTEIN_ID ACV54269.1 GB:DB_XREF GI:257473949 LENGTH 131 SQ:AASEQ MAQQEPSIDQWLAEAKQDPNAAQCGMYLTHNGIVRITPKKQVREGVEGLGEVAQVEFSYDAAGVEAAVQEALTWPGVYYVRTWLNEGVLNVGDSIMYVLIGADIRPNCIDALQKLVGKIKNDLVEEKEIYA GT:EXON 1|1-131:0| HM:PFM:NREP 1 HM:PFM:REP 14->122|PF02391|3.2e-08|22.1|104/117|MoaE| RP:SCP:NREP 1 RP:SCP:REP 21->131|1fm0E|8e-07|21.2|99/142|d.41.5.1| HM:SCP:REP 1->123|1fm0E_|0.00012|25.2|111/149|d.41.5.1|1/1|Molybdopterin synthase subunit MoaE| OP:NHOMO 13 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111-11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 131-132| PSIPRED cccccccHHHHHHHHHccccHHHccEEEEEEEEEEcccHHHHHccccccccEEEEEEEEcHHHHHHHHHHHHHcccHHHHHHHHHHcccccccEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHcccc //