[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54273.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:138 amino acids
:PSIPRED
:HMM:PFM   28->89 PF04401 * DUF540 2.4e-06 21.0 62/188  
:HMM:PFM   91->133 PF01485 * IBR 8.8e-05 26.8 41/64  
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54273.1 GT:GENE ACV54273.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 377636..378052 GB:FROM 377636 GB:TO 378052 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV54273.1 GB:DB_XREF GI:257473953 LENGTH 138 SQ:AASEQ MKGFLERLQWKLSGMMQGRRGADTFSNFLVVAGIVLLFASLIPGLDLLSWVALIVLAYSLFRSYSKNIAARDRENATFERIVEKPRKQLSLMRKKWTNRKTTRYFKCKGCGQVLSVPRGKGTLRVVCPKCKTETKQKS GT:EXON 1|1-138:0| TM:NTM 1 TM:REGION 32->54| HM:PFM:NREP 2 HM:PFM:REP 28->89|PF04401|2.4e-06|21.0|62/188|DUF540| HM:PFM:REP 91->133|PF01485|8.8e-05|26.8|41/64|IBR| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------11----------1-------1-1-1--1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccHHEEEEEccccccEEEEEccccEEEEEccccccHHHHcc //