[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54282.1
DDBJ      :             death-on-curing family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  139/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.265.1
:129 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->117 3dd7A PDBj 8e-09 27.5 %
:RPS:PDB   14->126 3dd7A PDBj 1e-19 25.2 %
:HMM:SCOP  59->129 2g03A1 a.265.1.1 * 3.8e-05 27.9 %
:RPS:PFM   59->90 PF02661 * Fic 1e-05 56.2 %
:HMM:PFM   11->90 PF02661 * Fic 5.5e-16 41.0 78/96  
:BLT:SWISS 14->117 DOC_BPP1 5e-09 28.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54282.1 GT:GENE ACV54282.1 GT:PRODUCT death-on-curing family protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(387470..387859) GB:FROM 387470 GB:TO 387859 GB:DIRECTION - GB:PRODUCT death-on-curing family protein GB:NOTE TIGRFAM: death-on-curing family protein; PFAM: filamentation induced by cAMP protein Fic; KEGG: mno:Mnod_8345 death-on-curing family protein GB:PROTEIN_ID ACV54282.1 GB:DB_XREF GI:257473962 InterPro:IPR003812 InterPro:IPR006440 LENGTH 129 SQ:AASEQ MSGRDPSPIPKHIVLAIHEDQLKRNGGMPGVRDEGLLNSALAQPFASFGGQDLYPSVHEKAARYGYGVIKNHPFDDGNKRTGTALIIAFLHGNGVKFKPRTQDFFDTVIAVANGTMSYDELVAWIEKQI GT:EXON 1|1-129:0| BL:SWS:NREP 1 BL:SWS:REP 14->117|DOC_BPP1|5e-09|28.4|102/100| BL:PDB:NREP 1 BL:PDB:REP 14->117|3dd7A|8e-09|27.5|102/123| RP:PDB:NREP 1 RP:PDB:REP 14->126|3dd7A|1e-19|25.2|111/123| RP:PFM:NREP 1 RP:PFM:REP 59->90|PF02661|1e-05|56.2|32/95|Fic| HM:PFM:NREP 1 HM:PFM:REP 11->90|PF02661|5.5e-16|41.0|78/96|Fic| HM:SCP:REP 59->129|2g03A1|3.8e-05|27.9|68/0|a.265.1.1|1/1|Fic-like| OP:NHOMO 149 OP:NHOMOORG 139 OP:PATTERN -------------------------------------------------------------------- --1-1----------11--------1-------1-1--1---11---1--1-11--------1--------1---11---1------------------------1--1---------------3111111--1-1-111----2--11-122-------------1-11--------------1-------1----------------1----------------------1--------------------------------------1----------------------------------------------------1--------12-1----------1---1----1--1-11------1--1---1111--------------111111111111111-11-1111-1-1-1----1-11------1-----2-----11111111-121---1-------------------------------------------------------------------------1-----1-111----------------21-------------1--------1--1--111----------------------------1-11------------------------1----------------------1-----------------------------------------1----------------------------------------1111-1---------------1-1------------------------------1--------2--------------------1-1--111--------11----------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 122 STR:RPRED 94.6 SQ:SECSTR #######cccHHcHHHHHHHHHHHHccccccccTTHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHTTcccccccTTHHHHHHHHHTTcccHHHHHHHHHHHH DISOP:02AL 129-130| PSIPRED cccccEEEccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccHHHHHHHHHHcc //