[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54301.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:241 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   48->69 PF03745 * DUF309 0.00073 40.9 22/62  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54301.1 GT:GENE ACV54301.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 405380..406105 GB:FROM 405380 GB:TO 406105 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE KEGG: hha:Hhal_0380 cobalt transport protein GB:PROTEIN_ID ACV54301.1 GB:DB_XREF GI:257473981 LENGTH 241 SQ:AASEQ METSSQARPFARPDLRAGLFGLDPRTHLLAVVAFGVASIVLTGLLETALLQVAAALYLAGNGRARLALRSCASFAVVAGLSFLPLPGLYGVLFVSLLHMVPPFTAGCALFSLSPSAIMCALARWRVPQRVLVGVCMLFRFASVLSFEARSIVRGIRLRGVFPRAIDVALHPALAYECCYTPLVMRCLRLSAELAASAELRGIEADGVRTSVHHVGFEARDALAAVAVLAVCAGLCVWGKVA GT:EXON 1|1-241:0| TM:NTM 4 TM:REGION 32->54| TM:REGION 83->105| TM:REGION 126->148| TM:REGION 216->238| SEG 48->59|allqvaaalyla| SEG 187->200|lrlsaelaasaelr| SEG 221->236|alaavavlavcaglcv| HM:PFM:NREP 1 HM:PFM:REP 48->69|PF03745|0.00073|40.9|22/62|DUF309| OP:NHOMO 10 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------2-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---111----------------------------------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 241-242| PSIPRED ccccHHccHHHccccccHHHcccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHc //