[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54309.1
DDBJ      :             iron dependent repressor
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5a.76.1
:123 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   7->79 2h09A PDBj 8e-06 34.2 %
:RPS:SCOP  7->55 1on1A1  a.4.5.24 * 5e-05 24.5 %
:HMM:SCOP  5->65 1g3sA1 a.4.5.24 * 1.6e-10 47.5 %
:HMM:SCOP  65->120 1g3sA2 a.76.1.1 * 1.4e-09 39.3 %
:RPS:PFM   7->36 PF01325 * Fe_dep_repress 2e-05 60.0 %
:HMM:PFM   7->58 PF01325 * Fe_dep_repress 5.7e-17 40.4 52/60  
:HMM:PFM   65->120 PF02742 * Fe_dep_repr_C 4.6e-12 35.7 56/71  
:BLT:SWISS 7->79 MNTR_ECOLI 2e-05 34.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54309.1 GT:GENE ACV54309.1 GT:PRODUCT iron dependent repressor GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 415196..415567 GB:FROM 415196 GB:TO 415567 GB:DIRECTION + GB:PRODUCT iron dependent repressor GB:NOTE PFAM: iron dependent repressor; SMART: iron dependent repressor; KEGG: sus:Acid_2178 DtxR family iron dependent repressor GB:PROTEIN_ID ACV54309.1 GB:DB_XREF GI:257473989 InterPro:IPR001367 LENGTH 123 SQ:AASEQ MKQPVHESAEDYLKAVLALEREHGYVRAVDVAGRLGVSKASVSKALSKLERQKLVHVVAHDVRLTAEGRAVAERVSERHAFFRALLRAAGVEAVVADEEACRLEHCLCEDSFRKLVTALDARG GT:EXON 1|1-123:0| BL:SWS:NREP 1 BL:SWS:REP 7->79|MNTR_ECOLI|2e-05|34.2|73/155| SEG 37->49|vskasvskalskl| SEG 80->100|affrallraagveavvadeea| BL:PDB:NREP 1 BL:PDB:REP 7->79|2h09A|8e-06|34.2|73/127| RP:PFM:NREP 1 RP:PFM:REP 7->36|PF01325|2e-05|60.0|30/59|Fe_dep_repress| HM:PFM:NREP 2 HM:PFM:REP 7->58|PF01325|5.7e-17|40.4|52/60|Fe_dep_repress| HM:PFM:REP 65->120|PF02742|4.6e-12|35.7|56/71|Fe_dep_repr_C| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01325|IPR001367| GO:PFM GO:0005506|"GO:iron ion binding"|PF01325|IPR001367| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01325|IPR001367| RP:SCP:NREP 1 RP:SCP:REP 7->55|1on1A1|5e-05|24.5|49/56|a.4.5.24| HM:SCP:REP 5->65|1g3sA1|1.6e-10|47.5|61/0|a.4.5.24|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 65->120|1g3sA2|1.4e-09|39.3|56/0|a.76.1.1|1/1|Iron-dependent repressor protein, dimerization domain| OP:NHOMO 3 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------3------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 114 STR:RPRED 92.7 SQ:SECSTR ######HHHHHHHHHHHHHHHHHccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEETTEEEEcHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHTTTccHHHHHHHHHHTT### PSIPRED ccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEccccEEEcHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHHcccc //