[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54310.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  35/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:188 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   37->157 PF06353 * DUF1062 6e-19 43.3 %
:HMM:PFM   37->165 PF06353 * DUF1062 2.5e-30 36.4 129/142  
:HMM:PFM   20->39 PF09297 * zf-NADH-PPase 0.00068 50.0 20/32  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54310.1 GT:GENE ACV54310.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 415916..416482 GB:FROM 415916 GB:TO 416482 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: plu:plu3925 hypothetical protein GB:PROTEIN_ID ACV54310.1 GB:DB_XREF GI:257473990 LENGTH 188 SQ:AASEQ MKTSIWRVEATAAPVALRPCGTCGADAEFASTGLFRVNAQKKRLDVWLIYRCATCGSVWNSAVISRGRPGSIDREELERFTGNDPVMALWCALDVGLLRRNGARRGKVAFVVEGDRPAGGEDCRVEIDGGDLAGLRLAEVLRAKLGVSRSGLERLVEAGDVSAADGADVLAAKLRPHQTILVRGRREQ GT:EXON 1|1-188:0| SEG 158->172|agdvsaadgadvlaa| RP:PFM:NREP 1 RP:PFM:REP 37->157|PF06353|6e-19|43.3|120/144|DUF1062| HM:PFM:NREP 2 HM:PFM:REP 37->165|PF06353|2.5e-30|36.4|129/142|DUF1062| HM:PFM:REP 20->39|PF09297|0.00068|50.0|20/32|zf-NADH-PPase| OP:NHOMO 39 OP:NHOMOORG 35 OP:PATTERN -------------------------------------------------------------------- ----2---------------------------------------------------------------1-----------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------1--------------------------------------------------------------------1----------1--111111-111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------111---1-1-111111-1221211------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 188-189| PSIPRED cccEEEEEEEEEccHHHHccccccccccccccccEEEcccccEEEEEEEEEEEccccccccHHEEcccHHHccHHHHHHHHcccHHHHHHHHHcHHHHHHHccccccccEEEEEccccccccEEEEEcccccHHHHHHHHHHHHHcccHHHHHHHHHccccccccHHHHHccccccccEEEEEEcccc //