[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54314.1
DDBJ      :             cobalt transport protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  33/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:242 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   107->202 PF02361 * CbiQ 5e-05 33.3 %
:HMM:PFM   23->203 PF02361 * CbiQ 8.5e-16 26.0 181/224  
:BLT:SWISS 144->215 YBAF_BACSU 3e-04 33.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54314.1 GT:GENE ACV54314.1 GT:PRODUCT cobalt transport protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 418430..419158 GB:FROM 418430 GB:TO 419158 GB:DIRECTION + GB:PRODUCT cobalt transport protein GB:NOTE PFAM: cobalt transport protein; KEGG: hha:Hhal_0380 cobalt transport protein GB:PROTEIN_ID ACV54314.1 GB:DB_XREF GI:257473994 InterPro:IPR003339 LENGTH 242 SQ:AASEQ MQATYALEDRRVLGRAPRSGVLDLDPRTIMGVLLAASVVAFMSKSLTVELGLVLGVALLQALTGHVRMALAFAGGYAVLWAVLNLVFPHVGGVAATMFTISFTFSRKIFLCLMVGSLLVAECSVHRLTAALERLRVPQVVLIPLTVTMRYFPALKDEMAHIRDAMRLRDIPASERLECFVVPLIMSATTTADELSRAATCRGIENPVRSTDTERLRMHAADWAVLAASAAAVVVVALWGGAY GT:EXON 1|1-242:0| BL:SWS:NREP 1 BL:SWS:REP 144->215|YBAF_BACSU|3e-04|33.3|72/265| TM:NTM 5 TM:REGION 34->56| TM:REGION 67->89| TM:REGION 108->130| TM:REGION 135->157| TM:REGION 218->239| SEG 46->64|ltvelglvlgvallqaltg| SEG 219->241|aadwavlaasaaavvvvalwgga| RP:PFM:NREP 1 RP:PFM:REP 107->202|PF02361|5e-05|33.3|96/213|CbiQ| HM:PFM:NREP 1 HM:PFM:REP 23->203|PF02361|8.5e-16|26.0|181/224|CbiQ| GO:PFM:NREP 3 GO:PFM GO:0006824|"GO:cobalt ion transport"|PF02361|IPR003339| GO:PFM GO:0009236|"GO:cobalamin biosynthetic process"|PF02361|IPR003339| GO:PFM GO:0015087|"GO:cobalt ion transmembrane transporter activity"|PF02361|IPR003339| OP:NHOMO 49 OP:NHOMOORG 35 OP:PATTERN --------------------------------1-1--------------------------------- ------------1-----------------------------------------------11---------1111-----82---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------1--1----1111--11111---------------------------1111--1------11--------1-----221-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------5---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 242-243| PSIPRED cccHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEcccHHHHHHHHHHHHHHHHHHHHcccc //