[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54327.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:216 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   25->211 PF09605 * Trep_Strep 4e-13 29.3 %
:HMM:PFM   24->211 PF09605 * Trep_Strep 7.5e-39 29.0 183/186  
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54327.1 GT:GENE ACV54327.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(435284..435934) GB:FROM 435284 GB:TO 435934 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE TIGRFAM: conserved hypothetical protein GB:PROTEIN_ID ACV54327.1 GB:DB_XREF GI:257474007 InterPro:IPR011733 LENGTH 216 SQ:AASEQ MSTEKTIDTTRGARGRASKKSIATRDVMTVAAMMVLTFLVCMVTGPLTMPFPFVYLYLCAGIQMFLCATFYLVVANRLNKHGVFLVWGIVYGTVLALSGYVFLLPYFAGVAAICELAMIGKDAYRSPVRNTVGWTIWAVGMVIGNAVPVWAAWDAYVAKATTDGFTAPVLTMQLDLLSNPLHLLGACAITAVLAVLGCLFGNRLLRKHFKKAGIVK GT:EXON 1|1-216:0| TM:NTM 6 TM:REGION 23->45| TM:REGION 50->72| TM:REGION 76->98| TM:REGION 101->123| TM:REGION 129->151| TM:REGION 182->204| RP:PFM:NREP 1 RP:PFM:REP 25->211|PF09605|4e-13|29.3|184/186|Trep_Strep| HM:PFM:NREP 1 HM:PFM:REP 24->211|PF09605|7.5e-39|29.0|183/186|Trep_Strep| OP:NHOMO 12 OP:NHOMOORG 9 OP:PATTERN --------------------------------1----------------------------------- -----------------------------------------------------------------------1----11--4-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------1-----------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 15-34,216-217| PSIPRED cccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //