[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54336.1
DDBJ      :             prevent-host-death family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.306.1
:66 amino acids
:PSIPRED
:RPS:SCOP  6->49 2a6qB1  d.306.1.1 * 5e-04 20.5 %
:HMM:SCOP  4->49 2a6qA1 d.306.1.1 * 7.2e-06 23.3 %
:HMM:PFM   6->49 PF02604 * PhdYeFM 1.6e-08 15.9 44/75  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54336.1 GT:GENE ACV54336.1 GT:PRODUCT prevent-host-death family protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(447911..448111) GB:FROM 447911 GB:TO 448111 GB:DIRECTION - GB:PRODUCT prevent-host-death family protein GB:NOTE TIGRFAM: prevent-host-death family protein; KEGG: gur:Gura_1262 prevent-host-death family protein GB:PROTEIN_ID ACV54336.1 GB:DB_XREF GI:257474016 InterPro:IPR006442 LENGTH 66 SQ:AASEQ MSAPIIRSSTDIRRDYNSIEALAKETGKPIYLTKNGRASLVVMDAAAFDYDRYVGLLVDEAAVHRS GT:EXON 1|1-66:0| HM:PFM:NREP 1 HM:PFM:REP 6->49|PF02604|1.6e-08|15.9|44/75|PhdYeFM| RP:SCP:NREP 1 RP:SCP:REP 6->49|2a6qB1|5e-04|20.5|44/55|d.306.1.1| HM:SCP:REP 4->49|2a6qA1|7.2e-06|23.3|43/0|d.306.1.1|1/1|YefM-like| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccccEEEEHHHHHHHHHHHHHHHHHccccEEEEEcccEEEEEEcHHHHcHHHHHHHHEEHHHHccc //