[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54341.1
DDBJ      :             Ethyl tert-butyl ether degradation EthD
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:231 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   1->94 3bf4A PDBj 3e-07 12.8 %
:RPS:PDB   120->216 3bf4A PDBj 8e-09 10.1 %
:RPS:SCOP  5->92 2ftrA1  d.58.4.15 * 8e-04 15.9 %
:RPS:SCOP  134->216 2ftrA1  d.58.4.15 * 2e-06 17.1 %
:HMM:SCOP  1->103 2ftrA1 d.58.4.15 * 4.6e-09 33.7 %
:HMM:SCOP  120->228 2ftrA1 d.58.4.15 * 2.6e-13 29.0 %
:RPS:PFM   4->93 PF07110 * EthD 8e-07 34.1 %
:RPS:PFM   123->216 PF07110 * EthD 9e-09 34.1 %
:HMM:PFM   5->103 PF07110 * EthD 4.5e-09 29.0 93/103  
:HMM:PFM   123->218 PF07110 * EthD 7e-09 23.6 89/103  
:BLT:SWISS 83->188 COAE_PROAC 7e-04 30.9 %
:REPEAT 2|1->87|120->209

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54341.1 GT:GENE ACV54341.1 GT:PRODUCT Ethyl tert-butyl ether degradation EthD GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 451156..451851 GB:FROM 451156 GB:TO 451851 GB:DIRECTION + GB:PRODUCT Ethyl tert-butyl ether degradation EthD GB:NOTE PFAM: Ethyl tert-butyl ether degradation EthD; KEGG: bxe:Bxe_A3617 hypothetical protein GB:PROTEIN_ID ACV54341.1 GB:DB_XREF GI:257474021 InterPro:IPR009799 LENGTH 231 SQ:AASEQ MISRINLLKRKEGLTAEEFAAYLTQAHGELLATMPFLKGCETNVVVDNEQRSPFDRGSTEIDGYTEMFFDSYGDMVRGMAALEEALATDYAQFAAPGIPALVAVKKVDTPVPAYLDDVKLIKRMSFLGRKDGVSAAVFQDEWWQMHSALVKTMTGYAGYNQNLVIDRIVDGESVPFEELPIEGVVEFWFENMKAFDECYGSPAFKRTGAHGTEFIDNITTYLVEAQPIAMA GT:EXON 1|1-231:0| BL:SWS:NREP 1 BL:SWS:REP 83->188|COAE_PROAC|7e-04|30.9|94/100| NREPEAT 1 REPEAT 2|1->87|120->209| RP:PDB:NREP 2 RP:PDB:REP 1->94|3bf4A|3e-07|12.8|88/109| RP:PDB:REP 120->216|3bf4A|8e-09|10.1|89/109| RP:PFM:NREP 2 RP:PFM:REP 4->93|PF07110|8e-07|34.1|85/99|EthD| RP:PFM:REP 123->216|PF07110|9e-09|34.1|88/99|EthD| HM:PFM:NREP 2 HM:PFM:REP 5->103|PF07110|4.5e-09|29.0|93/103|EthD| HM:PFM:REP 123->218|PF07110|7e-09|23.6|89/103|EthD| RP:SCP:NREP 2 RP:SCP:REP 5->92|2ftrA1|8e-04|15.9|74/103|d.58.4.15| RP:SCP:REP 134->216|2ftrA1|2e-06|17.1|76/103|d.58.4.15| HM:SCP:REP 1->103|2ftrA1|4.6e-09|33.7|95/0|d.58.4.15|1/2|Dimeric alpha+beta barrel| HM:SCP:REP 120->228|2ftrA1|2.6e-13|29.0|100/0|d.58.4.15|2/2|Dimeric alpha+beta barrel| OP:NHOMO 7 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------4---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 181 STR:RPRED 78.4 SQ:SECSTR ccccEEEEEEEccTTccccHHHHHHTHHHHHHHGGGccEEEEEEcccccc#####TTccccEEEEEEEEccHHHHHHHHHHHHHHHH#TGGGTc#########################ccccEEEEEEEccTTccccHHHHHHTHHHHHHHGGGccEEEEEEccccccTTcc##TTccccEEEEEEEEccHHHHHHH##HHHHHHHHHTGGGTcc############### PSIPRED ccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccccccEEEcEEEEEcccccccccccHHHHHccHHHHHHHHHHccccccHHHHHHHHHccHHHccHHHccccccccccccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHccccccEEEEEEccccccccccccccccccEEEEEEcccHHHHHHHcccHHHHHHHHHHHHHcccccEEEEEEcccccc //