[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54345.1
DDBJ      :             NADH:flavin oxidoreductase/NADH oxidase
Swiss-Prot:             

Homologs  Archaea  28/68 : Bacteria  633/915 : Eukaryota  123/199 : Viruses  0/175   --->[See Alignment]
c.1.4c.3.1c.4.1
:699 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->699 1ps9A PDBj 3e-35 29.2 %
:RPS:PDB   3->696 1djqA PDBj 9e-48 20.2 %
:RPS:SCOP  6->378 1z41A1  c.1.4.1 * 2e-54 27.1 %
:RPS:SCOP  372->529 1ps9A3  c.4.1.1 * 7e-09 25.5 %
:RPS:SCOP  516->650 1d7yA2  c.3.1.5 * 2e-10 16.7 %
:HMM:SCOP  1->408 1gwjA_ c.1.4.1 * 2.5e-76 33.9 %
:HMM:SCOP  386->699 1f8rA1 c.3.1.2 * 3.2e-35 28.3 %
:RPS:PFM   7->367 PF00724 * Oxidored_FMN 7e-44 38.3 %
:RPS:PFM   622->697 PF12252 * SidE 6e-04 34.2 %
:HMM:PFM   6->370 PF00724 * Oxidored_FMN 6.8e-56 32.0 331/341  
:HMM:PFM   563->631 PF00070 * Pyr_redox 2.7e-09 29.0 69/81  
:HMM:PFM   416->582 PF07992 * Pyr_redox_2 2e-14 33.3 144/202  
:BLT:SWISS 1->699 NADO_THEBR 3e-51 33.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54345.1 GT:GENE ACV54345.1 GT:PRODUCT NADH:flavin oxidoreductase/NADH oxidase GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 455820..457919 GB:FROM 455820 GB:TO 457919 GB:DIRECTION + GB:PRODUCT NADH:flavin oxidoreductase/NADH oxidase GB:NOTE PFAM: NADH:flavin oxidoreductase/NADH oxidase; FAD- dependent pyridine nucleotide-disulphide oxidoreductase; alanine dehydrogenase/PNT domain protein; KEGG: pha:PSHAa0892 electron acceptor reductase/NADH oxidase, FAD binding, iron-sulfur cluster binding site GB:PROTEIN_ID ACV54345.1 GB:DB_XREF GI:257474025 InterPro:IPR000103 InterPro:IPR001155 InterPro:IPR001327 InterPro:IPR007698 InterPro:IPR013027 LENGTH 699 SQ:AASEQ MKAYEKLLEPITIGTHQWRNRMVKAPSSAMSWDPGQFCNERIIGLYDAISKGGASAIILGGMICDDPATLIDDADGGVYTVETYPLGGLYDDKFIPGLSQLADAVHGNGCELIAQIFQNGAAIKTKGGAWCSSTLTADELPSPEPYCNPTRGLSLEEIEAFKDRYFAAAERAKKAGLDGIEVHAANGYFLLSFVSRVWNHRDDQYGCQSVENRTRLVCEIIRGVKERCGEDFIVGVRTNGQEYGHPDAITIEEGVEIAKFYDAAGADYISVTGYGYGPVPMQFALDYWMYPSPDEDMKQFLDRLDGEGLSIPPAAAIKQAVSAPVFGVGFATPEKAEAALEKGEIDLAMFARALWADPDMPNKIAEGAPEDIRRCNHCATCDELRMNETPHRRCRVNPAFLREREMAVVPAETKKKVLVVGAGAAGLEAARVAAERGHEVTLCEKESVLALELNLATMVKGTVCENVPALIDWLTSQAKKTPGLTIKTKTTVTPDFVRAMKPDAVIVATGGVYGAPDVPGIDLGIVSTVPQLTRLAEKPLKLFGANAINKLSQIALPGIGKNCVVLGAQIEGVQGAIFLRKRGKNVTVLEDLDTVGEGLPPRYKSRSLKWLRENDVETITGVEYRSIDKRGITYVKDGEERYLKADSILVFKSPGSGLSLYDQLKDLAPEVYPIGACQGPGSTLMVDAVGQGRAVALKL GT:EXON 1|1-699:0| BL:SWS:NREP 1 BL:SWS:REP 1->699|NADO_THEBR|3e-51|33.0|642/651| SEG 417->437|vlvvgagaagleaarvaaerg| BL:PDB:NREP 1 BL:PDB:REP 3->699|1ps9A|3e-35|29.2|647/671| RP:PDB:NREP 1 RP:PDB:REP 3->696|1djqA|9e-48|20.2|647/729| RP:PFM:NREP 2 RP:PFM:REP 7->367|PF00724|7e-44|38.3|329/340|Oxidored_FMN| RP:PFM:REP 622->697|PF12252|6e-04|34.2|76/1398|SidE| HM:PFM:NREP 3 HM:PFM:REP 6->370|PF00724|6.8e-56|32.0|331/341|Oxidored_FMN| HM:PFM:REP 563->631|PF00070|2.7e-09|29.0|69/81|Pyr_redox| HM:PFM:REP 416->582|PF07992|2e-14|33.3|144/202|Pyr_redox_2| GO:PFM:NREP 2 GO:PFM GO:0010181|"GO:FMN binding"|PF00724|IPR001155| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00724|IPR001155| RP:SCP:NREP 3 RP:SCP:REP 6->378|1z41A1|2e-54|27.1|325/337|c.1.4.1| RP:SCP:REP 372->529|1ps9A3|7e-09|25.5|153/179|c.4.1.1| RP:SCP:REP 516->650|1d7yA2|2e-10|16.7|114/121|c.3.1.5| HM:SCP:REP 1->408|1gwjA_|2.5e-76|33.9|357/374|c.1.4.1|1/1|FMN-linked oxidoreductases| HM:SCP:REP 386->699|1f8rA1|3.2e-35|28.3|293/371|c.3.1.2|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 2614 OP:NHOMOORG 784 OP:PATTERN ------1111111121----1--32111-121-----------11----1231--------111---- 111-11121111-241111-13--2611111154343AEB-2-23-2122211123-4--1-512-746231111-----622-1-1-1111-------1-2-2-71211---------------1--232----111111---1-5122221--11------1---3231------------21211---21222222232122222211223222311112213333332322222222222222222221-13-11----112--11---1311--1111-----------------1111111111111211---1112-1366222222322312BB1-1-3-1-11-1--744131-7-1334-1112118221-----42457--121211222222221-3-33233434344-6332223455453312112522224452222222234222412------------------------------24A11275149BEADC466657798777818F795655125571111153564232313433211-----11-422-9641-1-13---1-111142342111114-21121---------------------1143453-734513555537433333434355---1---------23462552333233322-322233223233322222356565332122222222221212241222222--322333322333---1-----122213443111215---------776683743351A989686C5B8875969---------1356633333545225624244222------11441111--------2-1------1111---111-11--------1-1-----211 ----743-841-12259868776EEE72311111111111111332756BFLKJ66332333636123-45861B2211257658513-5TA95J54442323BJC-32B---------------------------------2---------------------------57---211----1178H958711OJQb1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 699 STR:RPRED 100.0 SQ:SECSTR ccGGGGGGccEEETTEEEcccEEEcccccccTTTcHHHHHHHHHHHHHHHHTTccEEEEEEEEccTTccccTTccccTTcccTTcccEcccHHHHHHHHHHHHHHHHTTcEEEEEEEccGGGTTTccccEEcccccccccTTcccccEEHEEccHHHHHHHHHHHHHHHHHHHHHTccEEEEEEcTTcHHHHHHcTTTcccccTTccHcHHHHHHHHHHHHHHHHHHHTTTcEEEEEEEEEccccTTcccTTTHHHHHHHHHTTTccEEEEEEcccTTGGGTcccTTTGGGTcccTTHEccccTccTTTTHHHHHHHHTTccccEEEcccccHHHHHHHHHTTccccEEEcHHHHHcTTHHHHHHTTcGGGccccccccHHHHHHHHccccccccccTTTTTHHHHccccccccccccccEEEEEcccHHHHHHHHHHHHTTcEEEEEcccccTTTTHHHHTTcTTcGGGGHHHHHHHHHHHHHHTTcTTcccHHHHHTccccEEEEcccEEEccccccTTTccccTTccTTcTTTccTTcTTEEcHHHHHHTccccccEEEEEEcccccHHHHHHHHHHHTTcEEEEEEcccTTTHHHHTTcHHHHHHHHHHTTcEEEETEEEEEEETTEcccccccccEEEEccEEEEHHHHHHHHTTHHHHHTTccEEEEcGGGTccccccHHHHHHHHHHHHHHH PSIPRED ccccccccccEEEccEEEcccEEEcccccccccccccccHHHHHHHHHHHHccccEEEEEEEEEcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccEEEEEEccccccccccccccccccccccccccccccccccEEccHHHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHccHHHcccccccccccHHHHHHHHHHHHHHHHHHcccccEEEEEEcHHHccccccccHHHHHHHHHHHHHccccEEEEcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccEEEEccccHHHHHHHHHcccccEEEEcHHHHHcHHHHHHHHccccccEEccccHHHHHHHHHcccccEEEEEEHHHHHcccccccccccccEEEEEcccHHHHHHHHHHHHcccEEEEEEccccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHcccEEEEcccccHHHHHHccccEEEEccccEEccccccccccccEEEEEEEcccccccccccccccccHHHHccccccccEEEEEcccHHHHHHHHHHHHcccEEEEEEEcccccccccHHHHHHHHHHHHHcccEEEccEEEEEEEcccEEEEEcccEEEEEccEEEEEccEEccHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHHHHHHHc //