[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54354.1
DDBJ      :             fumarate reductase/succinate dehydrogenase flavoprotein domain protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  169/915 : Eukaryota  15/199 : Viruses  0/175   --->[See Alignment]
c.3.1d.168.1
:567 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   139->567 1qo8A PDBj 5e-27 30.4 %
:RPS:PDB   152->541 1e39A PDBj 4e-29 20.4 %
:RPS:SCOP  106->387 1d4cA2  c.3.1.4 * 7e-18 19.8 %
:RPS:SCOP  369->494 1d4cA3  d.168.1.1 * 5e-18 28.8 %
:HMM:SCOP  85->533 1jnrA2 c.3.1.4 * 2.3e-34 28.0 %
:RPS:PFM   130->535 PF00890 * FAD_binding_2 2e-19 39.5 %
:HMM:PFM   107->542 PF00890 * FAD_binding_2 6.5e-56 29.8 383/421  
:HMM:PFM   9->33 PF10518 * TAT_signal 1e-05 52.0 25/26  
:BLT:SWISS 139->567 FRD2_SHEFN 1e-26 30.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54354.1 GT:GENE ACV54354.1 GT:PRODUCT fumarate reductase/succinate dehydrogenase flavoprotein domain protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(466503..468206) GB:FROM 466503 GB:TO 468206 GB:DIRECTION - GB:PRODUCT fumarate reductase/succinate dehydrogenase flavoprotein domain protein GB:NOTE PFAM: fumarate reductase/succinate dehydrogenase flavoprotein domain protein; FAD dependent oxidoreductase; KEGG: shw:Sputw3181_0556 fumarate reductase/succinate dehydrogenase flavoprotein domain- containing protein GB:PROTEIN_ID ACV54354.1 GB:DB_XREF GI:257474034 InterPro:IPR003953 InterPro:IPR006076 InterPro:IPR006311 LENGTH 567 SQ:AASEQ MNQPDKSTLSRRSFLTGAAATAGLAAFAGLSGCAPQSTTGDAANAATASGASASGSASAGAMQTTDPAQAVWPVVEEVEVGAAGEGKIAFVAEPIAASDIVATHDVDVVVCGLGPAGDAAALACAEQGLKTVAVEKQTTGNYNSATIGGTNSKLHEHWGMTYDTDAWISDAMIDCAFQGDMELYRHWLEKNGEAVDWYISHFDNQNLDDYPLTFAAGDFPDFRDEWDKTSLSRSWNTSLNLPYPPGELAGILAGILEQAGVEIRYSCPACQLVTDDSGKVTGVIVQSDQGFEQYNCAKGVVLATGGYEFNQQMLKERCRPRGVPGSWLTGAFGNTGDGHQMGLAVGAAEDEFPHAIMLDPEQLMPYLRVNKLGERFTPEYEPYGHLALAIQAQPGTYDFYVVDSAIGEKIDKIWTPSSSCYGPKEVWTAAAMSEKALKADTLEELAKLMEVPEAQFVATIERWNEMAAAGKDEDFNFPGEMMMTIDTPPYYATKEFADGLCTAGGLLVDTECRVLDKDRQPIDGLFAIGLTSGGMFFNTYPHNLNCLSHTRNCLMGYTVGQVLGDKA GT:EXON 1|1-567:0| BL:SWS:NREP 1 BL:SWS:REP 139->567|FRD2_SHEFN|1e-26|30.4|388/588| SEG 14->30|fltgaaataglaafagl| SEG 37->61|sttgdaanaatasgasasgsasaga| SEG 74->86|vveevevgaageg| SEG 112->129|glgpagdaaalacaeqgl| BL:PDB:NREP 1 BL:PDB:REP 139->567|1qo8A|5e-27|30.4|388/564| RP:PDB:NREP 1 RP:PDB:REP 152->541|1e39A|4e-29|20.4|373/568| RP:PFM:NREP 1 RP:PFM:REP 130->535|PF00890|2e-19|39.5|319/375|FAD_binding_2| HM:PFM:NREP 2 HM:PFM:REP 107->542|PF00890|6.5e-56|29.8|383/421|FAD_binding_2| HM:PFM:REP 9->33|PF10518|1e-05|52.0|25/26|TAT_signal| GO:PFM:NREP 2 GO:PFM GO:0009055|"GO:electron carrier activity"|PF00890|IPR003953| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00890|IPR003953| RP:SCP:NREP 2 RP:SCP:REP 106->387|1d4cA2|7e-18|19.8|268/322|c.3.1.4| RP:SCP:REP 369->494|1d4cA3|5e-18|28.8|111/146|d.168.1.1| HM:SCP:REP 85->533|1jnrA2|2.3e-34|28.0|268/357|c.3.1.4|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 516 OP:NHOMOORG 185 OP:PATTERN ------------------------------1------------------------------------- ----1---215---38822-26--5721222587773878-2-3----------1-----225----1-----------BkH1------------------------------------------------------11------1-------------------------------------1-------------------------1-----------1---111111------------------11--12-311213122311-1-21-1-111--------11-------------------------11---1111-A5-1------------------24-2------LH-----1-------1---------------412------1---------------1--2--3-1-1-----------12---1-----1--1-----------------------------------------------54--3222----21---------2------2-21221-----3-----3---------------------------1---1---------2115-----21-2-----13------------------1-------1------2-21321-5431243541552---------------31-11-----------------------------222211------------------------------------------------------------------------------------3-----------211-----------------------1----------------------------------------------------------------------------- -------------1--1--111-----------111----------------37-------------------------------------11-1-----------------------------------------------------------------------------1----1--------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 463 STR:RPRED 81.7 SQ:SECSTR ######################################################################################################ccEEcEEEEcccHHHHHHHHHHHHHTccEEEEcccccccTTGGGccccccccccccTTGGGccccEEccccHHHHHTTccccHHHHHHHHHHHTTTcccHHHHHHHHHHHHHHHHHHHHTTccccEEEccTTcccccEEEcTTTccHHHHHHHHHHTTcEEEccEEEEEEEEcTTccEEEEEEEETTTEEEEEEEEEEEEcccccTTcHHHHHHHcGGGTTcTccccccTTcccHHHHHHHHTTccTcEEEEEEEETTTcccccTHEcTTccccccTTccHHHHHHHHHTcGGGcEEEEEEHHHHHHcTHHHHHHHHTccccTHHHHHHHTTccEEEccHHHHHHHHTccHHHHHHHHHHHHHHHHTTccTTTccccccccccccccEEEEEEEEEEEEEccEEEccTTcEEEcTTccEEEEEEEccTTEEcccTTcccTTTcccT##THHHHHHHHHHHHHHHH PSIPRED ccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccEEEEEEEccHHHHHHHHHHHHHccccEEEEEccccccccccccccccHHHHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEccccccccHHHcccccccccEEccccccccHHHHHHHHHHHHHHcccEEEEcEEEEEEEEEcccEEEEEEEEEcccEEEEEEccEEEEEcccccccHHHHHHHHccccccccccccccccccHHHHHHHHccccccccccEEEEcccccccEEEEcccccccccccccccHHHHHHHHcccccEEEEEcHHHHHHHcccccccccccccHHHHHHHHccccEEEcccHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHccccccccccccccEEEEEEEEEEEEEcccEEEccccEEEccccccccccHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHcc //