[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54371.1
DDBJ      :             TrpR like protein, YerC/YecD
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  87/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.12
:100 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->97 3g1cA PDBj 3e-15 41.5 %
:RPS:PDB   2->80 1co0A PDBj 1e-04 22.8 %
:HMM:SCOP  1->95 1trrA_ a.4.12.1 * 2.1e-17 38.9 %
:RPS:PFM   8->92 PF01371 * Trp_repressor 8e-10 43.5 %
:HMM:PFM   10->90 PF01371 * Trp_repressor 6e-22 34.6 81/88  
:BLT:SWISS 4->96 YERC_BACSU 4e-16 41.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54371.1 GT:GENE ACV54371.1 GT:PRODUCT TrpR like protein, YerC/YecD GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 491382..491684 GB:FROM 491382 GB:TO 491684 GB:DIRECTION + GB:PRODUCT TrpR like protein, YerC/YecD GB:NOTE TIGRFAM: TrpR like protein, YerC/YecD; PFAM: Trp repressor; KEGG: bha:BH0639 hypothetical protein GB:PROTEIN_ID ACV54371.1 GB:DB_XREF GI:257474051 InterPro:IPR000831 InterPro:IPR013368 LENGTH 100 SQ:AASEQ MSDLRTPEVEDLLRVFAALDDEDVIFSLLEDLFTIREIKETSQRLAVARQLDAGKSYSAIEEATGASATTIARVSKCLSYGAGGYNAALNVLDDAEKKRR GT:EXON 1|1-100:0| BL:SWS:NREP 1 BL:SWS:REP 4->96|YERC_BACSU|4e-16|41.9|93/100| BL:PDB:NREP 1 BL:PDB:REP 4->97|3g1cA|3e-15|41.5|94/97| RP:PDB:NREP 1 RP:PDB:REP 2->80|1co0A|1e-04|22.8|79/105| RP:PFM:NREP 1 RP:PFM:REP 8->92|PF01371|8e-10|43.5|85/88|Trp_repressor| HM:PFM:NREP 1 HM:PFM:REP 10->90|PF01371|6e-22|34.6|81/88|Trp_repressor| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01371|IPR000831| GO:PFM GO:0005622|"GO:intracellular"|PF01371|IPR000831| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01371|IPR000831| HM:SCP:REP 1->95|1trrA_|2.1e-17|38.9|95/0|a.4.12.1|1/1|TrpR-like| OP:NHOMO 87 OP:NHOMOORG 87 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------1-------------------------------111----------------------------------------------------------------------------------------------------------11-111---------------111111---111111111111111-1111111111111111111----------------------------------------------------------------------11-11-------1-11---11111-1111111-11111111111111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1-----------------------------------------------------------------------------------1-----------------------1-------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 96 STR:RPRED 96.0 SQ:SECSTR #ccccTTccHHHHHHHHHHHTTTTTHHHHHHTTccTHHHHHHHHHHHHHHHHHccccccHHHHHTccHHHHHHHHHHHHHcccHHHHHHHHHTcccc### PSIPRED ccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcc //