[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54376.1
DDBJ      :             NAD(P)H dehydrogenase (quinone)
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  95/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.23.5
:186 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   68->165 2hpvA PDBj 1e-12 34.4 %
:RPS:PDB   43->185 1d4aA PDBj 1e-14 17.6 %
:RPS:SCOP  43->185 1d4aA  c.23.5.3 * 4e-15 17.6 %
:HMM:SCOP  1->185 1dxqA_ c.23.5.3 * 3.9e-29 31.1 %
:RPS:PFM   75->178 PF02525 * Flavodoxin_2 1e-07 34.3 %
:HMM:PFM   1->184 PF02525 * Flavodoxin_2 1.6e-26 27.6 174/196  
:BLT:SWISS 55->185 AZOR_COPPD 1e-20 36.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54376.1 GT:GENE ACV54376.1 GT:PRODUCT NAD(P)H dehydrogenase (quinone) GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 496335..496895 GB:FROM 496335 GB:TO 496895 GB:DIRECTION + GB:PRODUCT NAD(P)H dehydrogenase (quinone) GB:NOTE PFAM: NAD(P)H dehydrogenase (quinone); KEGG: bpa:BPP3780 acyl carrier protein phosphodiesterase GB:PROTEIN_ID ACV54376.1 GB:DB_XREF GI:257474056 InterPro:IPR003680 LENGTH 186 SQ:AASEQ MTTLFVNACMRGEASRTLALCREYLERFDDVVEVDVAALDLKPFDADRVAYRTEKQRAGEWDDPIFSLSRQFAEADDIVIGVPYWDLSFPAAFKTYLEHVSVCELTFHYTEDARCEGICKAKRITYITTCGGFVEGANFGYEYIVGIAKMFGIPEVRFVAAEGLDIVGIDVQEQMDKARAQMAKLD GT:EXON 1|1-186:0| BL:SWS:NREP 1 BL:SWS:REP 55->185|AZOR_COPPD|1e-20|36.9|130/201| SEG 29->41|ddvvevdvaaldl| BL:PDB:NREP 1 BL:PDB:REP 68->165|2hpvA|1e-12|34.4|96/204| RP:PDB:NREP 1 RP:PDB:REP 43->185|1d4aA|1e-14|17.6|142/273| RP:PFM:NREP 1 RP:PFM:REP 75->178|PF02525|1e-07|34.3|102/193|Flavodoxin_2| HM:PFM:NREP 1 HM:PFM:REP 1->184|PF02525|1.6e-26|27.6|174/196|Flavodoxin_2| GO:PFM:NREP 3 GO:PFM GO:0009055|"GO:electron carrier activity"|PF02525|IPR003680| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF02525|IPR003680| GO:PFM GO:0050662|"GO:coenzyme binding"|PF02525|IPR003680| RP:SCP:NREP 1 RP:SCP:REP 43->185|1d4aA|4e-15|17.6|142/273|c.23.5.3| HM:SCP:REP 1->185|1dxqA_|3.9e-29|31.1|183/0|c.23.5.3|1/1|Flavoproteins| OP:NHOMO 105 OP:NHOMOORG 96 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------1111111111-111111-12211111-11--1------1--1--------------1--1-1---------------------------------------------------------------------1--11---------------1111----------------------11---------------------------------------------------------1---11-------1-----1------------1----------------------------------------11-1-11---------------------------------11----------------------------------------------1-------------------------------------------1-1--------------------------------------------------------------------------------------------------------------------------------------1----------11111---11111-----111111222112212-111-------------1----------111-1--112--------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 183 STR:RPRED 98.4 SQ:SECSTR ##EEEEEccccGGGcHHHHHHHHHHHHHHHHcTTcEEEEEEcTTcccHHHHHHHHHHHTcccHHHHHHHHHHHHccEEEEEEEccTTcccHHHHHHHHHHcccTTTccTTccGGcGcTTTTcEEEEEEEcccGcTTcTTccHHHTTTTGGGTcEEcccEEETTGGGccHHHHHHHHHHHHHHTTG# DISOP:02AL 186-187| PSIPRED cEEEEEEEcccccccHHHHHHHHHHHHcccEEEEEEHHcccccccHHHHccccccccccccHHHHHHHHHHHHHccEEEEEcccccccccHHHHHHHHHHHHccccccccccccccccccccEEEEEEEcccccccHHHHHHHHHHHHHHHcccccEEEEEEEEccccHHHHHHHHHHHHHHHHcc //