[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54380.1
DDBJ      :             Silent information regulator protein Sir2
Swiss-Prot:             

Homologs  Archaea  35/68 : Bacteria  562/915 : Eukaryota  192/199 : Viruses  1/175   --->[See Alignment]
c.31.1
:248 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   24->245 1yc2E PDBj 5e-45 46.1 %
:RPS:PDB   23->245 2b4yB PDBj 4e-24 33.0 %
:RPS:SCOP  23->247 1iciA  c.31.1.5 * 2e-64 39.6 %
:HMM:SCOP  1->249 1j8fA_ c.31.1.5 * 1.4e-79 44.3 %
:RPS:PFM   28->207 PF02146 * SIR2 6e-41 51.4 %
:HMM:PFM   28->207 PF02146 * SIR2 9.1e-55 42.9 177/181  
:BLT:SWISS 23->247 NPD_CLOAB 1e-70 55.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54380.1 GT:GENE ACV54380.1 GT:PRODUCT Silent information regulator protein Sir2 GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(499492..500238) GB:FROM 499492 GB:TO 500238 GB:DIRECTION - GB:PRODUCT Silent information regulator protein Sir2 GB:NOTE PFAM: Silent information regulator protein Sir2; KEGG: sat:SYN_01020 Sir2 family NAD-dependent deacetylase GB:PROTEIN_ID ACV54380.1 GB:DB_XREF GI:257474060 InterPro:IPR003000 LENGTH 248 SQ:AASEQ MDETVRAIETFRSWVADTPPGGLVFFGGAGVSTESGIPDFRSPDGLYAQKYPYPPEQMVSRSFFDANPSAFFDFYCDRMLALDAQPNRTHRKLAELEQAGTLAAVVTQNIDGLHQKAGSKNVLELHGSVLRNFCMACGAAYSVDNLLALRAQSDDSVPRCPACGGIVKPDVVLYEEPLNERTVHGAVNAIAQADLLVVAGTSLAVYPAAGLIDFFTGRRLVIVNRTPTPRDRQADLCIAANVGDVFDF GT:EXON 1|1-248:0| BL:SWS:NREP 1 BL:SWS:REP 23->247|NPD_CLOAB|1e-70|55.2|221/245| BL:PDB:NREP 1 BL:PDB:REP 24->245|1yc2E|5e-45|46.1|217/250| RP:PDB:NREP 1 RP:PDB:REP 23->245|2b4yB|4e-24|33.0|215/259| RP:PFM:NREP 1 RP:PFM:REP 28->207|PF02146|6e-41|51.4|173/178|SIR2| HM:PFM:NREP 1 HM:PFM:REP 28->207|PF02146|9.1e-55|42.9|177/181|SIR2| GO:PFM:NREP 6 GO:PFM GO:0006342|"GO:chromatin silencing"|PF02146|IPR003000| GO:PFM GO:0006476|"GO:protein amino acid deacetylation"|PF02146|IPR003000| GO:PFM GO:0008270|"GO:zinc ion binding"|PF02146|IPR003000| GO:PFM GO:0016811|"GO:hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides"|PF02146|IPR003000| GO:PFM GO:0045449|"GO:regulation of transcription"|PF02146|IPR003000| GO:PFM GO:0070403|"GO:NAD binding"|PF02146|IPR003000| RP:SCP:NREP 1 RP:SCP:REP 23->247|1iciA|2e-64|39.6|217/256|c.31.1.5| HM:SCP:REP 1->249|1j8fA_|1.4e-79|44.3|246/0|c.31.1.5|1/1|DHS-like NAD/FAD-binding domain| OP:NHOMO 1678 OP:NHOMOORG 790 OP:PATTERN 11---11111111111-12222221--1---11----------------1---11111111---1--1 1-1-22-222211112211-12112211111222222111-2111122-111111121--1221321121111111111-1111-11111111111---11111111111---------------1----1---1-11133---511------------------------------------11111---111111111111111111111111111222-1--111111111111111111111111111111111111111111132-1-111----------1--------------------------1----------1-1111111111111111111-11111111-1---121-11-112-111111-111-----11222---11111------------11111111--1-------------1111---11111111---------11--111------------------------------1111-11--12222222222122122222122322222--1111-12222--1---2----11----------212122111---11----11111111211212222-1---1111-2111111111--121--11-121-11111111111111111111111--1-21-------111111111111111-1-1111111111111111111111111111111111111111111111111111-111111111111-------------1122----11--1-11---11111111-112-2222121211--22433----------111111111111111111111111-------1111111--------1-1----------1--------------1111111111-1- 11--544-72333454541456565665544432323444444344325413452463333353344223454454343444443422-444566344332-2543-5FEECA86953133374DA4B3JqA-C7E4435A4474274546416657685467C752623665A83223R1213352232546633343 -------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 245 STR:RPRED 98.8 SQ:SECSTR ###HHHcHHHHHHHHHHccEccEEEEEcGGGGGGGTccccccTTccGHHGccccHGGTccHHHHHHcHHHHHHHHHHHHHHHTccccHHHHHHHHHHTTTcEEEEEEcccccHHHHTTcccEEETTEEEEEEEETTTccEEEcccccccccGGGccccccTTTcccEEEEEccTTccccHHHHHHHHHHHHHccEEEEEccccccTTGGHHHHHHTTccEEEEEccccTTGGGccEEEEccHHHHHHH PSIPRED ccHHHHHHHHHHHHHHHcccccEEEEEcccccccccccccccccccccccccccHHHHccHHHHHHcHHHHHHHHHHHHccccccccHHHHHHHHHHHccccEEEEEcccccHHHHcccccEEEccccEEEEEEccccccccccccEEEcccccccccccccccccccccEEEccccccHHHHHHHHHHHHHccEEEEEccccccccHHHHHHHcccccEEEEcccccccccEEEEEEEccHHHHHcc //