[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54403.1
DDBJ      :             major facilitator superfamily MFS_1
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:432 amino acids
:PSIPRED
:RPS:SCOP  264->379 1pv6A  f.38.1.2 * 1e-04 20.7 %
:HMM:SCOP  1->411 1pw4A_ f.38.1.1 * 4.1e-46 19.5 %
:HMM:PFM   41->347 PF07690 * MFS_1 5.9e-25 23.2 280/353  
:HMM:PFM   307->426 PF07690 * MFS_1 3.3e-06 16.0 119/353  
:BLT:SWISS 13->402 YBFB_BACSU 1e-07 23.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54403.1 GT:GENE ACV54403.1 GT:PRODUCT major facilitator superfamily MFS_1 GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 531168..532466 GB:FROM 531168 GB:TO 532466 GB:DIRECTION + GB:PRODUCT major facilitator superfamily MFS_1 GB:NOTE PFAM: major facilitator superfamily MFS_1; KEGG: bpt:Bpet3502 hypothetical protein GB:PROTEIN_ID ACV54403.1 GB:DB_XREF GI:257474083 InterPro:IPR007114 InterPro:IPR011701 LENGTH 432 SQ:AASEQ MESSHALKNSGKFAWILVLGLGLMSAGTTGSYSVVAGCFMTPVCEDLGIDYNMFSYYFTATLVGVAVGMMCVGKILPKVVGRWTHVAVAAVLLAAGAAMAFYSNVWLFLLSGLIIGFGMSFTTGLCMSAVIDQWFRKKAGLAIGLAWTVNSVYMVVMSPVITAVIESVGWRNGYLVLAAVSALVVIPSIVFIIRFKPADKGMLPYGYSEAESIGQDAGVEIAATRGVPFKVAVKSPAFIACVLFLCLVQITVCMNQLFPTYAVEVGLGAMTGGIMVSAASMFDIFLNPAVGSSCDKLGSFIALVLWVVVSILSFVMLIFAAGQPWLAILGAGVNDVMYVVAGAGLTCLLMSVFGSRDYGRIFGIVCGVAYIAGAFGMPIMTAVYSATGTFNAVFGLCIVMNVAIIGLILVIKATSKKLQWVEGEDETPVALH GT:EXON 1|1-432:0| BL:SWS:NREP 1 BL:SWS:REP 13->402|YBFB_BACSU|1e-07|23.8|382/416| TM:NTM 12 TM:REGION 8->30| TM:REGION 58->80| TM:REGION 86->108| TM:REGION 113->135| TM:REGION 143->165| TM:REGION 173->194| TM:REGION 234->256| TM:REGION 266->288| TM:REGION 297->319| TM:REGION 329->351| TM:REGION 361->383| TM:REGION 392->414| SEG 86->100|vavaavllaagaama| SEG 107->118|lfllsgliigfg| SEG 175->190|lvlaavsalvvipsiv| HM:PFM:NREP 2 HM:PFM:REP 41->347|PF07690|5.9e-25|23.2|280/353|MFS_1| HM:PFM:REP 307->426|PF07690|3.3e-06|16.0|119/353|MFS_1| RP:SCP:NREP 1 RP:SCP:REP 264->379|1pv6A|1e-04|20.7|116/417|f.38.1.2| HM:SCP:REP 1->411|1pw4A_|4.1e-46|19.5|406/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 27 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------1-116-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--2-111----------------------------------------------------------1---------------------------------43-------------------------------------------------------------------------------------------------------------------------------------------1-----------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHcccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccc //