[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54407.1
DDBJ      :             thiamine pyrophosphate protein domain protein TPP-binding
Swiss-Prot:             

Homologs  Archaea  55/68 : Bacteria  149/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
c.36.1
:297 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   99->273 1kekA PDBj 9e-19 34.7 %
:RPS:PDB   7->223 3ea4A PDBj 3e-13 14.6 %
:RPS:SCOP  12->296 1b0pA2  c.36.1.12 * 3e-15 23.7 %
:HMM:SCOP  2->299 1b0pA2 c.36.1.12 * 4.6e-65 30.8 %
:HMM:PFM   46->210 PF02775 * TPP_enzyme_C 4.2e-25 26.0 146/150  
:BLT:SWISS 8->293 PORB_METTH 3e-72 47.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54407.1 GT:GENE ACV54407.1 GT:PRODUCT thiamine pyrophosphate protein domain protein TPP-binding GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 536951..537844 GB:FROM 536951 GB:TO 537844 GB:DIRECTION + GB:PRODUCT thiamine pyrophosphate protein domain protein TPP-binding GB:NOTE PFAM: thiamine pyrophosphate protein domain protein TPP-binding; KEGG: sfu:Sfum_2795 thiamine pyrophosphate enzyme domain protein TPP-binding GB:PROTEIN_ID ACV54407.1 GB:DB_XREF GI:257474087 InterPro:IPR011766 LENGTH 297 SQ:AASEQ MAVNAKNITDDEFFFGHKACAGCGGSLAVRAALKVLGPNAVCALPAGCMSAVGFNFPQLSFANNAMITPFAATASVLTGIEAGLRAQGKKPDDCTVVGFAGDGGTADIGIQALSGAIDRNDDVLYICYDNEAYMNTGIQKSSLTPFGAKTTTTPAGSNMRGCLTQKKNMFEIVAAHGIPYAATASIGYLNDFMRKVEHAASIRGTKYIHVMAPCPTGWGCGVDETVDISKDIVDCGLWYLAEYEGGAFKLNRNPREFASVEAYLRRQGRFKALTDEDVASVVAARDAKWEVMRRDWA GT:EXON 1|1-297:0| BL:SWS:NREP 1 BL:SWS:REP 8->293|PORB_METTH|3e-72|47.9|284/288| BL:PDB:NREP 1 BL:PDB:REP 99->273|1kekA|9e-19|34.7|170/1231| RP:PDB:NREP 1 RP:PDB:REP 7->223|3ea4A|3e-13|14.6|206/581| HM:PFM:NREP 1 HM:PFM:REP 46->210|PF02775|4.2e-25|26.0|146/150|TPP_enzyme_C| RP:SCP:NREP 1 RP:SCP:REP 12->296|1b0pA2|3e-15|23.7|279/447|c.36.1.12| HM:SCP:REP 2->299|1b0pA2|4.6e-65|30.8|289/0|c.36.1.12|1/1|Thiamin diphosphate-binding fold (THDP-binding)| OP:NHOMO 381 OP:NHOMOORG 210 OP:PATTERN --2132313333333222233332-----1--12222422222433231132213332234-212--- -11-------------------------------------11--------------------1---------------12211131221111------------------------------------1------------111---111-----------------11-------------------11------------------------------1----111111----------------------2----------------------111--------------------------------------------22322-------2-2122221112322221-21---23224244432221-1--------------------1------------------------------------------------------------------1-1-------------------------------------------------------------------------1-------1----1----------------1---212211312322323222223332222--34-----------11111111111111--1--------------------------------------------1-----------------------------------1-1--------------------1---------------------------------------------------------------------------------------------------------------------------11--------------21--------------------------2122212131--- ---1-------1-------------------------------------------------------------------------------------------------------------------------------------------------------1-------------2-----1---------1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 290 STR:RPRED 97.6 SQ:SECSTR ######HHHHHccccccccTTcccHHHHHHHHHHHHTTccEEEEcccHHHHHHHHHcccccTTcEEcccccccTTcccHHHHHHHHHHHcTTccEccEEEEEEHHHHHTTTHHHHHHHTTccEEEEEEEccccHHHHHHHHHHcTTcccccccccGGcccGTTcccccHHHHHHHTTccEEEEccGTcHGGHHHHHHHHHHccccEEEEEEccTTccccccccccTTHHHHHHTTTTcccHHHHHHHHHHHHHHHHHHHHcccccGGGGcTTccccccHHHHHHHHHHHHHHcTTc# DISOP:02AL 297-298| PSIPRED ccccHHHccccccccccccccccccHHHHHHHHHHccccEEEEccccHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHccHHHHHHHHHccccEEEEEEEccccccccccccccccccHHHccccccccccccccccccHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHccccEEEEEEccccccccccHHHHHHHHHHHHHccccccEEEEccHHHccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHc //