[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54408.1
DDBJ      :             transcriptional regulator, XRE family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:189 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   7->55 2croA PDBj 8e-07 24.5 %
:RPS:PDB   88->182 3b9jK PDBj 7e-04 15.9 %
:RPS:SCOP  7->57 1xwrA1  a.35.1.9 * 3e-07 9.8 %
:HMM:SCOP  1->43 1adrA_ a.35.1.2 * 7.9e-06 32.6 %
:HMM:PFM   10->50 PF01381 * HTH_3 2.2e-10 34.1 41/55  
:HMM:PFM   129->185 PF01991 * vATP-synt_E 2.1e-05 25.0 56/198  
:BLT:SWISS 69->176 MLTF_MAGSM 6e-05 27.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54408.1 GT:GENE ACV54408.1 GT:PRODUCT transcriptional regulator, XRE family GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 537977..538546 GB:FROM 537977 GB:TO 538546 GB:DIRECTION + GB:PRODUCT transcriptional regulator, XRE family GB:NOTE PFAM: helix-turn-helix domain protein; KEGG: sat:SYN_00015 transcriptional regulator GB:PROTEIN_ID ACV54408.1 GB:DB_XREF GI:257474088 InterPro:IPR001387 LENGTH 189 SQ:AASEQ MSKDLTAQDIKRIRRKYGLTQQGFARLLGLGEASVVRYENGQTPSKANANLIRAADNPAFMRDCFERDGDLLSHEQRGKAEQIIYALVTFDEDGDIMDINEMYEITLQQEVLNEQAAQLMGDTINLLLAAREQEDAIAEAVYEDVLKQISHIKPRIISEGHLNTVRLSEIRGQIECLKNMVDSRQAKAA GT:EXON 1|1-189:0| BL:SWS:NREP 1 BL:SWS:REP 69->176|MLTF_MAGSM|6e-05|27.9|104/100| RP:PDB:NREP 2 RP:PDB:REP 7->55|2croA|8e-07|24.5|49/65| RP:PDB:REP 88->182|3b9jK|7e-04|15.9|88/747| HM:PFM:NREP 2 HM:PFM:REP 10->50|PF01381|2.2e-10|34.1|41/55|HTH_3| HM:PFM:REP 129->185|PF01991|2.1e-05|25.0|56/198|vATP-synt_E| RP:SCP:NREP 1 RP:SCP:REP 7->57|1xwrA1|3e-07|9.8|51/79|a.35.1.9| HM:SCP:REP 1->43|1adrA_|7.9e-06|32.6|43/0|a.35.1.2|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 4 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------2----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 174 STR:RPRED 92.1 SQ:SECSTR ######HHHHHHHHHHTTccHHHHHHHHTccHHHHHHHHTTcccccTTHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHTTTcGGGHHHHHHHHHHHTTTTccEEEEEEEEEEEccccccHHHHHHHHHHHHHHHHEHHHHHHHHTccccccTTcccccccTTTc##ccccGGGccc####### DISOP:02AL 34-34,59-59,62-62,67-67,129-129,137-137,143-143,146-146,189-190| PSIPRED ccccccHHHHHHHHHHccccHHHHHHHHccccccEEEEccccccccccccEEEEcccHHHHHHHHHHcccHHHHHHHccHHHHHEEEEEEcccccEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEcccccccEEEHHHHHHHHHHHHHHHHHHHHHcc //